SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020563 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020563
Domain Number 1 Region: 33-89
Classification Level Classification E-value
Superfamily BPTI-like 1.28e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0029
Further Details:      
 
Domain Number 2 Region: 128-184
Classification Level Classification E-value
Superfamily BPTI-like 2.13e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020563   Gene: ENSNLEG00000016916   Transcript: ENSNLET00000021587
Sequence length 252
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:46436010:46466076:-1 gene:ENSNLEG00000016916 transcript:ENSNLET00000021587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLCGLRRSRALLALLGSLLLSGVLAADRERSIHDFCLVSKVVGRCRASMPRWWYNVTD
GSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATNRNAADSSVPSAPRRQDSE
DHSSDMFNYEEYCAAKAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACM
LRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQERALRTIWSSGD
DKEQLVKNTYVL
Download sequence
Identical sequences G1S4X5
ENSNLEP00000020563 ENSNLEP00000020563 XP_003252717.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]