SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020577 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020577
Domain Number 1 Region: 46-173
Classification Level Classification E-value
Superfamily Sialidases 1.35e-34
Family Sialidases (neuraminidases) 0.0000656
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020577   Gene: ENSNLEG00000016947   Transcript: ENSNLET00000021601
Sequence length 184
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:15261283:15280287:-1 gene:ENSNLEG00000016947 transcript:ENSNLET00000021601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPADLPPRPMEEPPASSSARTETEEPGSSAEVMEEVTTCSFNSPLFQQEDDRGITYRIP
ALLYIPPTHTFLAFAEKRSTRRDEDALHLVLRRGLRIGRLVQWGPLKPLMEATLPGHRTM
NPCPVWERKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEDKHSACM
LHDQ
Download sequence
Identical sequences ENSNLEP00000020577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]