SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020603 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020603
Domain Number 1 Region: 493-611
Classification Level Classification E-value
Superfamily Cadherin-like 9.16e-32
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 395-497
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 162-283
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 602-706
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-22
Family Cadherin 0.0021
Further Details:      
 
Domain Number 5 Region: 275-393
Classification Level Classification E-value
Superfamily Cadherin-like 9.16e-16
Family Cadherin 0.011
Further Details:      
 
Domain Number 6 Region: 33-101
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000328
Family Cadherin 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020603
Domain Number - Region: 131-157
Classification Level Classification E-value
Superfamily Cadherin-like 0.00691
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020603   Gene: ENSNLEG00000016961   Transcript: ENSNLET00000021631
Sequence length 988
Comment pep:known_by_projection supercontig:Nleu1.0:GL397274.1:22704910:22903367:1 gene:ENSNLEG00000016961 transcript:ENSNLET00000021631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRMRTAGWARGWCLGCCLLLPLSLSLAAAKQLLRYRLAEEGPADVRIGNVASDLGIVTG
SGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPS
QSWVDLFEGRVIVLDINDNTPTFPSPVLTLTVEENRPAILRVLITDVNDNSPRFEKSVYE
ADLAENSAPGTPILQLRAADLDVGVNGQIEYVFGAATESVRRLLRLDETSGWLSVLHRID
REEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVPSIEIRKIGRIPLKDGVANVAE
DVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPASDTEGDQNKKKYFLHTSTPLD
YEATREFNVVIVAVDSGSPSLSSNNSLIVKVGDTNDNPPVFGQSVVEVYFPENNIPGERV
ATVLATDADSGKNAEIAYSLESSVMGIFAIDPDSGDILVNTVLDREQTDRYEFKVNAKDK
GIPVLQGSTTVIVQVADKNDNDPKFMQDVFTFYVKENLQPNSPVGMVTVMDADKGRNAEM
SLYIEENNNIFSIENDTGTIYSTMSFDREHQTTYTFRVKAVDGGDPPRSATATVSLFVMD
ENDNAPTVTLPKNISYTLLPPSSNVRTVVATVLATDSDDGINADLNYSIVGGNPFKLFEI
DPTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPSQSTTTLVHVFVNESVSNATVIDSQIA
RSLHTPLTQDIAGDPSYEISKQRLSIVIGVVAGIMTVILIILIVVMARYCRSKNKNGYEA
GKKDHEDFFTPQQHDKSKKPKKDKKNKKSKQPLYSSIVTVEASKPNGQRYDSVNEKLSDS
PSMGRYRSVNGGPGSPDLARHYKSSSPLPTVQLHPQSPTAGKKHQAVQDLPPANTFVGAG
DNISIGSDHCSEYSCQTNNKYSKQPFRRVTFSVVSQPQDPHQGSLQSCYDSGLEESETPS
SKSSSGPRLGALPLPEDNYERTTPDGSV
Download sequence
Identical sequences ENSNLEP00000020603 ENSNLEP00000020603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]