SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020630 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020630
Domain Number 1 Region: 250-316
Classification Level Classification E-value
Superfamily FnI-like domain 4.4e-16
Family VWC domain 0.0044
Further Details:      
 
Domain Number 2 Region: 32-97
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000942
Family VWC domain 0.017
Further Details:      
 
Domain Number 3 Region: 109-176
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000132
Family VWC domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020630   Gene: ENSNLEG00000016982   Transcript: ENSNLET00000021662
Sequence length 452
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:15543295:15577110:1 gene:ENSNLEG00000016982 transcript:ENSNLET00000021662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPEVRVLSSLLGLALLWFPLDSHARARPDMFCLFHGKRYSPGESWHPYLEPQGLMYCLR
CTCSESAHVSCYRLHCPPVHCPQPVTEPQQCCPRCVEPHTPSGLRAPPKSCQHNGTTYQH
GEIFSAHELFPSRLPNQCVLCSCTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASE
QSAEEDSVQSLHGVGHPQDPCSSDAGRKRGPGTPAPTGLSAPLSFIPRHFRPKGAGSTTV
KIVLKEKHKKACVHGGKTYSHGEVWHPAFRAFGPLPCILCTCEDGRQDCQRVTCPTEYPC
RHPEKVAGKCCKICPEDKADPGHSEISSTRCPKAPGRVLVHTSVSPSPDNLRRFALEHEA
SDLVEIYLWKLVKGEGWPTPSGVAHNLVSALRNLPLDSDQESQEARLPERGTALPAARWP
PRRSLERLPSPDPGAEGHGQSRQSDQDIITKT
Download sequence
Identical sequences ENSNLEP00000020630 ENSNLEP00000020630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]