SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020648 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020648
Domain Number 1 Region: 677-772
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000294
Family DEATH domain, DD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020648   Gene: ENSNLEG00000016995   Transcript: ENSNLET00000021680
Sequence length 781
Comment pep:known_by_projection supercontig:Nleu1.0:GL397274.1:27674371:27735657:1 gene:ENSNLEG00000016995 transcript:ENSNLET00000021680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHDECTPQQTMSSIQDTKAADIAAREELNVIETATVSPTNGEESHYTNQVQLEKNKTHMS
SALVEKENNASLNGRVLGREESQNKMFPDNAENEDDKQMEHMTVENINGNREEIHGIIQT
TEREIQETSESPREEMISSSIICDISKKYINSTLPNDSENIKHKNNIMEKEYLDVLSDET
GPQVSCYITAPSYVLQQLECRIINHMSSLIVGDNEELVSNVITIECSDKEKRVPFPIGIA
IPFTARYRGNYRDIMVKVCDINLQSSYLNPNSLEGMKGGYKGTCASVKVYKLGIFSVVSC
LKKESFTVTKKGLTLKSSMDSRISLNYPPGVFTSPVLVQLKIQPVDPALVAHLKAQQDTF
YSVQSTSPLIHIQHPSTYPFQKPVTLFLPCSPYLDKSNLGSEIDHKRRASATINRITSYF
NWTKSTSVRKPGKNASECLKLLGFRSQDSGWCGLDDVVVKTIQSGLVSVELYEHLERFIV
LHLSSTMDNSHLVTFVKSLEEAMLSTTACIVLSHQKDNPHRIAILVVPSKDLSQVLKDLR
LEGFGGPSEPSRHFQVREGEQLLLRFTGNIFASSNGKDYGKDYTLIFHLQRKPRLELQIK
EVDEFGNYSCPHYKGTIVVYKVPKGKIVPNLNQSLVINETHSQLPIFKLPLKLPKHKKLI
NRPQSTKRISKDPVEALWDNLLHWLAEELSEENAESLSSTLPLRRSTIQLIKLKNPDDLT
EQIHEFLCFWKKSLPTFTDKYRLLARHLRKIGRSDLAEELKFKWENKVFTEPQQWFDVAP
E
Download sequence
Identical sequences ENSNLEP00000020648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]