SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020669 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020669
Domain Number 1 Region: 138-334
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.98e-57
Family Prokaryotic proteases 0.000000623
Further Details:      
 
Domain Number 2 Region: 349-445
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-22
Family HtrA-like serine proteases 0.0032
Further Details:      
 
Domain Number 3 Region: 3-90
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000004
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 4 Region: 78-123
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000137
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020669   Gene: ENSNLEG00000017001   Transcript: ENSNLET00000021702
Sequence length 448
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:56746755:56800302:1 gene:ENSNLEG00000017001 transcript:ENSNLET00000021702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAAGCPERCEPARCPPQPEHCEGGRARDACGCCEVCGAPEGAACGLQEGPCGEGLQCVVP
FGVPASATVRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRRSERLHRPPVIVLQR
GACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSED
GLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSE
LRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPL
VNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTS
SKAKELKDRHRDFPDVTSGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVI
KRESTLNMVVRRGNEDIMITVIPEEIDP
Download sequence
Identical sequences G1S581
ENSNLEP00000020669 ENSNLEP00000020669 XP_003255169.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]