SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020674 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020674
Domain Number 1 Region: 33-337
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.46e-58
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000739
Further Details:      
 
Domain Number 2 Region: 332-478
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.86e-29
Family Ricin B-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020674   Gene: ENSNLEG00000017019   Transcript: ENSNLET00000021707
Sequence length 483
Comment pep:known_by_projection supercontig:Nleu1.0:GL397279.1:6449498:6476402:1 gene:ENSNLEG00000017019 transcript:ENSNLET00000021707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPLSLHPPCQPGLDPQFLKLRCICRCKEKKYDYDNLPRTSVIIAFYNEAWSTLLRTVYS
VLETSPDILLEEVILVDDYSDREHLKERLANELSGLPKVRLIRANKREGLVRARLLGASA
ARGDVLTFLDCHCECHEGWLEPLLQRIHEEESAVVCPVIDVIDWNTFEYLGNSGEPQIGG
FDWRLVFTWHVVPERERIRMRSPVDVIRSPTMAGGLFAVSKKYFEYLGSYDTGMEVWGGE
NLEFSFRIWQCGGVLETHPCSHVGHVFPKQAPYSRNKALANSVRAAEVWMDEFKELYYHR
NPRARLEPFGDVTERKQLRAKLQCKDFKWFLETVYPELHVPEDRPGFFGMLQNKGLTDYC
FDYNPPDENQIMGHQVILYLCHGMGQNQFFEYTSQKEIRYNTHQPEGCIAVEAGMDTLIM
HLCEETAPENQKFMLQEDGSLFHEQSKKCVQAARKESSDSFVPLLRDCTNSDHQKWFFKE
RML
Download sequence
Identical sequences ENSNLEP00000020674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]