SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020675 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020675
Domain Number 1 Region: 443-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000343
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 2 Region: 247-394
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000691
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 3 Region: 344-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020675
Domain Number - Region: 411-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0041
Family Laminin-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020675   Gene: ENSNLEG00000017020   Transcript: ENSNLET00000021708
Sequence length 645
Comment pep:known_by_projection supercontig:Nleu1.0:GL397294.1:14601109:14718516:-1 gene:ENSNLEG00000017020 transcript:ENSNLET00000021708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLPSLGGLALLCCAAAAAAAASAASAASAGNVTGSGGAAGQVDASPGPGLQGEPSHSF
PRATAPTAQAPRTGPPRATVHRPLAATSPAQSPETTPPRATAGPASTFQAPLGPSLTTPP
AAERTSTTSQAPTRPEPTTFSTTTGPAPTTPVATTVPAPTTPRTPTPDLPSSSSSSSSNS
SSSVLPTPPATEAPSSPPPGHQPVAKMPQKYLGKYACESNLKSKYLPLIQPVMNLRVSEA
VKMEYVCNCSVVGSLDVNRCSQTTGQCECRPGYQGLHCETCKEGFYLNYTSGLCQPCDCS
PHGALSILCNSSGKCQCKVGVIGSTCDRCQDGYYGFSKNGCLPCQCNNRSASCDALTGAC
LNCQENSKGNHCEECKEGFYQSPDATKECLRCPCSAVTSTGSCSIKSSELEPECDECKDG
YIGPNCNKCENGYYNFDSICRKCQCHGHVDPVKTPKICKPESGECINCLHNTTGFWCENC
LEGYVQDLEGNCIKKEVIVPTPEGSTILVSNASLTTSVPTPVINSTFTPTTLQTIFSVST
SENSTSALADVSWTQFNIIILTVIIIVVVLLMGFVGAVYMYREYQNRKLNAPFWTIELKE
DNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLTTPIHNYKA
Download sequence
Identical sequences ENSNLEP00000020675 ENSNLEP00000020675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]