SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020676 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020676
Domain Number 1 Region: 496-604
Classification Level Classification E-value
Superfamily SRCR-like 4.84e-47
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000471
Further Details:      
 
Domain Number 2 Region: 624-730
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000479
Further Details:      
 
Domain Number 3 Region: 885-990
Classification Level Classification E-value
Superfamily SRCR-like 5.36e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000572
Further Details:      
 
Domain Number 4 Region: 100-205
Classification Level Classification E-value
Superfamily SRCR-like 5.75e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000552
Further Details:      
 
Domain Number 5 Region: 754-858
Classification Level Classification E-value
Superfamily SRCR-like 1.01e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000471
Further Details:      
 
Domain Number 6 Region: 359-463
Classification Level Classification E-value
Superfamily SRCR-like 3.14e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000376
Further Details:      
 
Domain Number 7 Region: 230-333
Classification Level Classification E-value
Superfamily SRCR-like 6.15e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000471
Further Details:      
 
Domain Number 8 Region: 1131-1237
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000082
Further Details:      
 
Domain Number 9 Region: 1013-1125
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-34
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 10 Region: 1255-1364
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-34
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020676   Gene: ENSNLEG00000017018   Transcript: ENSNLET00000021709
Sequence length 1653
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:56847417:56910235:1 gene:ENSNLEG00000017018 transcript:ENSNLET00000021709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGISTVILEMCLLWGQVLSTGGWIPRIRDYASLIPSEVPLDTTVAEGNVYYGGSLSSFLH
PAGSPFPLELTLESTVAEGSLIPLESTLESTVAEGSDSGLALRLVNGDGMCQGRVEILYR
GSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVHCSGHESYLWS
CPHNGWLSHNCGHGEDAGVICSGRHQRSLLFTESWPVRISPVPTEGPESSLALRLVNGGD
RCRGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDV
RCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSVSQSRPTPSPDTWLTSHASTAGSESSL
ALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNAWFGQG
SGPIVLDDVRCSGYESSLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPRPGESPITDT
LPTITLPASTVGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQL
GCGWAMSAPGNARFGQGSGPIVLDDVRCSGNESYLWSCPHNGWLSHNCGHSEDAGVICSG
GPPAIVSSRMDKGFLCSSVGPESSLTLRLVNGSNRCQGRVEVLYRGSWGTVCDDSWDTND
ANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHE
DAGVICSGGPSRPWAPSPNTWPTSHASTAGSESSLALRLVNGGGRCQGRVEVLYRGSWGT
VCDDSWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNG
WLSHNCGHHEDAGVICSAAQSQSTPRPDTWLTTNLPASPIGSESSLALRLVNGGDRCQGR
VEVLYQGSWGTVCDDNWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGH
ESYLWSCPHNGWLTHNCGHREDAGVICSATQINSTTTDWWHPTITTTARPSSNCGGFLFS
ASGTFSSPSYPAYYPNNAKCVWEIEVNSGYRINLGFSNLQLEAHHNCSFDYVEIFDGSLN
SSLLLGKICNDTRQIFTSSYNRMTIHFRSDVSFQNTGFLAWYNSFPSDAALRLVNLNSSY
GLCAGRVEIYHGGTWGTVCDDSWTIQEAEVVCRQLGCGRAVSALGNAYFGSGSGPITLDD
VECSGTESTLWQCRNRGWFSHNCQHREDAGVICSGMAQCHGSPTFPLFVLTANYSCGGFL
SQPSGRFSSPFYPGNYPNNAKCVWDIEVQENYRVTVIFRDVQLEGGCNYDYIEVFDGPYH
SSPLIARVCDGARGSFISSSNFMSVRFISDHSITRKGFRAEYYSSPSNDSTNLLCLPNHM
RASVSRSYLQSLGFSASDLVISTWNGYYECRPQITPSLVIFTIPYSGCGTFKQADNDTID
YSNFLTAAVSGGIIKRRKDLRIHVSCRMLQNTWVNTMYIANDTIQVEKVQYGNFDVNISF
YTSSSFLYPVTSHPYYVDLNQDLYVQAEILHSDAALTLFVDTCVASPYSNDFTSLTYDLI
RSGCVRDDTYGPYSPPSPRIARFRFRAFRFLNRFPSVYLHCKMVVCRAYDSSSRCYRGCV
VRSKRDVGSYQEKVDVVLGPIQLQPPRREEEPR
Download sequence
Identical sequences ENSNLEP00000020676 ENSNLEP00000020676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]