SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020691 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020691
Domain Number 1 Region: 1214-1380
Classification Level Classification E-value
Superfamily C-type lectin-like 1.85e-76
Family Endostatin 0.0000000683
Further Details:      
 
Domain Number 2 Region: 40-235
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.45e-33
Family Laminin G-like module 0.024
Further Details:      
 
Domain Number 3 Region: 862-1020
Classification Level Classification E-value
Superfamily C-type lectin-like 8.95e-20
Family Endostatin 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020691   Gene: ENSNLEG00000017021   Transcript: ENSNLET00000021725
Sequence length 1386
Comment pep:known_by_projection supercontig:Nleu1.0:GL397279.1:6577552:6709566:1 gene:ENSNLEG00000017021 transcript:ENSNLET00000021725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRRNNGQCWCLLMLLSVSTPLPAVTQTRAATVSASQGHLDLTQLIGVPLPSSVSFVTG
YGGFPAYSFGPGANVGRPARTLIPSTFFRDFAISVMVKPSSTRGGVLFAITDAFQKVIYL
GLRLSGVEDGHQRIILYYTEPGSHVSQEAAAFSVPVMTHRWNRFAVIVQGEEVTLLMDCE
EHSRIPFQRSSQALAVESSAGIFVGNAGATGLERFTGSLQQLTVHDPRTPEELCDPEESS
ASGETSGLQEADGVAEILEAVTYTQALPKEAKVEPINTPPTPSSPFEDMELSGEPVPEGT
PETTNMSIIQHSSPEQGSGEILNDTLEGVHSVDGDPITDSGSGAGAFLDIAEEKNLAATT
AGLAEVPIGTAGEAEASSVPTGGPTLSMSTENPEERVTPGPDNEEGLAATAAGEAEALAS
TPGEVEASGVAPGELDLSMSIQSLGEEATVGPSSEDSLTTAAAATEVSVSTFEDEEASGV
PTDGLAPLTATMASEQAVTSGPGDEEDLAAATTEEPLITAGGEESGSPPPDGPPLPLPTV
APERGVTPAQREHVGMKGQAGPKREKGDAGEELPGPPEPSGPVGPTAGAEAEGSGLGWGS
DVGSGSGDLVGSEELLRGPPGPPGPPGLPGIPGKPGTDVFMGPPGSPGEDGPAGEPGPPG
PEGQPGVDGATGLPGMKGEKGARGPNGSVGEKGDPGNRGLPGPPGKKGQAGPPGVMGPPG
PPGPPGPPGPGCTMGLGFEDTEGSGSTQLLNEPKLSRPMAAIGPKGEKGDQGPKGERGMD
GASIVGPPGPRGPPGRIEVLSSSLINITHGFMNFSDIPELVGPPGPDGLPGLPXXXGPRG
PKGDTGLPGFPGLKGEQGEKGEPGAILTGDIPLERLMGKKGEPGMHGAPGPMVSQSISQR
VYGVCCGFQGRPGLNGLKGAKGDPGVIMQGPPGLPGPPGPPGPPGAVINIKGAIFPIPVR
PHCKMPVDTAHPGSPELITFHGVKGEKGSWGLPGSKGEKGDQGAQGPPGPPLDLAYLRHF
LNNLKGENGDKGFKGEKGEKGDINDGFLMSGPPGLPGNPGLAGPERETVVGPQGPPGAPG
LPGPPGFGRPGDPGPPGPPGPPGPPAILGAAVALPGPPGPPGQPGLPGSRNLVTAFSNMD
DMLQKAHLVIEGTFIYLRDSTEFFIRVRDGWKKLQLGELIPIPADSPPPPALSSNPHQLL
PPPNPISSANYEKPALHLAALNMPFSGDIRADFQCFKQARAAGLLSTYRAFLSSHLQDLS
TIVRKAERYSLPIVNLKGQVLFNNWDSIFSGHRGQFNMHIPIYSFDGRDVMTDPSWPQKV
IWHGSSPLGVRLVDNYCEAWRTADTAVTGLASPLSTGKILDQKAYSCANRLIVLCIENSF
MTDARK
Download sequence
Identical sequences ENSNLEP00000020691 ENSNLEP00000020691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]