SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020694 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020694
Domain Number 1 Region: 160-265
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-34
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 2 Region: 53-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-19
Family Spermadhesin, CUB domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020694   Gene: ENSNLEG00000017027   Transcript: ENSNLET00000021728
Sequence length 607
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:57085242:57104251:-1 gene:ENSNLEG00000017027 transcript:ENSNLET00000021728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVRRLMPLTLLILSCLAELTMAEAEGNSSCTVSLGGANMAETHKAMILQLNPNENCTW
TIERPENKSIRIIFSYVQLDPDGSCESENIKVFDGTSSNGPLLGQVCSKNDYVPVFESSS
STLTFQIVTDSARIQRTVFVFYYFFSPNISIPDCGGYLDTLEGSFTSPNYPKPHPELAYC
VWHIQVEKGYKIKLNFKEIFLEIDQQCKFDFLAIYDGPSTNSGLIGQVCGRVTPTFESSS
NSLTVVLSTDYANSYRGFSASYTSIYAENINTTSLTCSSDRMRVIISKSYLEAFNSNGNN
LQLKDPTCRPKLSNVVEFSIPLNGCGTIRKVEDQSITYTNIITFSASSTSEVITRQKQLQ
IIVKCEMGHNSTVEIIYITENDVIQNQNALGKYNTSMALFESNSFEKTLLESPYYVDLNQ
TLFVQVSLHTSDPNLVVFLDTCRASPTSDFASPTYDLIKSGCSRDETCKVYPLFGHYGRF
QFNAFKFLRSMSSVYLQCKVLICDSSDHQSRCNQGCVSRSKRDISSYKWKTDSIIGPIRL
KRDRSASGNSGFQHETHAEETPNQPFNSLHLFSFMVLVLNVVIVATITVRHFVNQRADYK
YQKLQNY
Download sequence
Identical sequences G1S5A6
ENSNLEP00000020694 ENSNLEP00000020694 XP_004087570.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]