SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020718 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020718
Domain Number 1 Region: 266-413
Classification Level Classification E-value
Superfamily TRAF domain-like 9.97e-47
Family MATH domain 0.00000126
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020718
Domain Number - Region: 85-110
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00785
Family SIAH, seven in absentia homolog 0.01
Further Details:      
 
Domain Number - Region: 227-262
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0863
Family Trimerization domain of TRAF 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020718   Gene: ENSNLEG00000017050   Transcript: ENSNLET00000021755
Sequence length 416
Comment pep:known_by_projection supercontig:Nleu1.0:GL397294.1:14908700:14935716:-1 gene:ENSNLEG00000017050 transcript:ENSNLET00000021755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSGSSPRPAPDENEFPFGCPLTVCQDPKEPRALCCAGCLSENPRSGEDQICPKCRGE
DLQSVSPGSRLRTQEKAHPEVAEAGVGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL
GFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQH
FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQ
QTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK
YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID
AFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST
Download sequence
Identical sequences G1S5D0
ENSNLEP00000020718 ENSNLEP00000020718 XP_003264117.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]