SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020730 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020730
Domain Number 1 Region: 65-191
Classification Level Classification E-value
Superfamily Lysozyme-like 2.01e-47
Family C-type lysozyme 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020730   Gene: ENSNLEG00000017070   Transcript: ENSNLET00000021767
Sequence length 193
Comment pep:novel supercontig:Nleu1.0:GL397323.1:13812878:13834739:-1 gene:ENSNLEG00000017070 transcript:ENSNLET00000021767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDAHLSCQSPTKWSSASSTDSTEKSASGAGTRNLPFQFCLRQALKMKVAGILTLIGCLVT
GAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQRVLDDGSIDYGIF
QINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEG
RDLSDWKKGCEVS
Download sequence
Identical sequences ENSNLEP00000020730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]