SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020765 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020765
Domain Number 1 Region: 152-217
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000111
Family Ovomucoid domain III-like 0.0046
Further Details:      
 
Domain Number 2 Region: 344-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000106
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 252-309
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000499
Family Ovomucoid domain III-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020765   Gene: ENSNLEG00000017101   Transcript: ENSNLET00000021805
Sequence length 454
Comment pep:known_by_projection supercontig:Nleu1.0:GL397279.1:8095255:8248359:1 gene:ENSNLEG00000017101 transcript:ENSNLET00000021805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNNEIIKPAKYFSELEKSILLALVEKYKYVLECKKSDARTIALKQRTWQALAHEYNSQP
SVSLRDFKQLKKCWENIKARTKKIMAHERREKVKRSVSPLLSTHVLGKEKIASMLPEQLY
FLQSPPEEEPEYHPDASAQELNVRESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTN
YIPVCGSNGDTYQNECFLRRAACKHQKEITVVARGPCYSDNGSGSGEGEEEGSGAEVHRK
HSKCGPCKYKAECDEDAENVGCVCNIDCSGYSFNPVCASDGSSYNNPCFVREASCIKQEQ
IDIRHLGHCTDTDDTSLLGKKDDGLQYRPDVKDASDQREDVYIGNHMPCPENLNGYCIHG
KCEFIYSTQKASCRCESGYTGQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVA
IVMCITRKCPKNNRGRRQKQNLGHFTSDTSSRMV
Download sequence
Identical sequences G1S5H7 K7DCF5
ENSNLEP00000020765 XP_003260339.1.23891 XP_003820688.1.60992 XP_008972331.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]