SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020776 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020776
Domain Number 1 Region: 122-241
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.04e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 227-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000122
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 3 Region: 5-53,95-151
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000706
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020776
Domain Number - Region: 269-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0019
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020776   Gene: ENSNLEG00000017109   Transcript: ENSNLET00000021816
Sequence length 431
Comment pep:known_by_projection supercontig:Nleu1.0:GL397280.1:29178343:29254888:-1 gene:ENSNLEG00000017109 transcript:ENSNLET00000021816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSPSLQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLCIPRTNPVYR
GPYSNPYSNPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESNQCVDVDECATDSHQ
CNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQLCANVPGSYSCTCNPGFT
LNEDGRSCQDVNECATENPCVQTCVNTYGSFICRCDPGYELEEDGVHCSDMDECSFSEFL
CQHECVNQPGTYFCSCPPGYILLDDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCIDP
IRCEEPYLRISDNRCMCPAENPGCRDQPFTILYRDMDVVSGRSVPADIFQMQATTRYPGA
YYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPREIQLDLEMITVNTVINFRGSSVI
RLRIYVSQYPF
Download sequence
Identical sequences ENSNLEP00000020776 ENSNLEP00000020776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]