SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020839 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020839
Domain Number 1 Region: 3-369
Classification Level Classification E-value
Superfamily L domain-like 1.5e-65
Family Internalin LRR domain 0.051
Further Details:      
 
Domain Number 2 Region: 510-608
Classification Level Classification E-value
Superfamily Immunoglobulin 2.02e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 594-695
Classification Level Classification E-value
Superfamily Immunoglobulin 6.24e-21
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 405-512
Classification Level Classification E-value
Superfamily Immunoglobulin 7.71e-16
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020839   Gene: ENSNLEG00000017137   Transcript: ENSNLET00000021882
Sequence length 1026
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:53700370:53747943:1 gene:ENSNLEG00000017137 transcript:ENSNLET00000021882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHLQSLREVKLNNNELETIPNLGPVSANVTLLSLAGNRIVEILPEHLKEFQSLETLDLS
SNNISELKTAFPALQLKYLYLNSNRVTSMEPGYFDNLANTLLVLKLNRNRISAIPPKMFK
LPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHN
NLTEITKGWLYGLLMLQELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLG
LSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKLRRLIL
QGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNAFSQMKKLQQLHLNTSSLLCDCQLK
WLPQWVAENNFQSFVNASCAHPQLLKGRSIFAVSPDGFVCDDFPKPQITVQPETQSAIKG
SNLSFICSAASSSDSPMTFAWKKDNELLHDAEMENYAHLRAQGGEVMEYTTILRLREVEF
ASEGKYQCVISNHFGSSYSVKAKLTVNMLPSFTKTPMDLTIRAGAMARLECAAVGHPAPQ
IAWQKDGGTDFPAARERRMHVMPEDDVFFIVDVKIEDIGVYSCTAQNNAGSISANATLTV
LETPSFLRPLLDRTVTKGETAVLQCIAGGSPPPKLNWTKDDSPLVVTERHFFAAGNQLLI
IVDSDVSDAGKYTCEMSNTLGTERGNVRLSVIPTPTCDSPQMTAPSLDDDGWATVGVVII
AVVCCVVGTSLVWVVIIYHTRRRNEDCSITNTDETNLPADTPSYLSSQGTLADRQDGYVS
SESGSHHQFVTSSGAGFFLPQHDSSGTCHIDNSSEADVEAATDLFLCPFLGSTGPVYLKG
NVYGSDAFETYHTGCSPDPRTALMDHYEPSYIKKKECYPRSHPSEESCERSFSNIAWPSH
VRKLLNTSYSQNEGPGMKNLCLNKSSLDFSANPESASVASSNSFMGTFGKALRRPHLDAY
SSFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERTDFQEENHICTFKQTLENYRTPNFQ
SSDLDT
Download sequence
Identical sequences ENSNLEP00000020839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]