SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020857 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000020857
Domain Number - Region: 132-210
Classification Level Classification E-value
Superfamily Caspase-like 0.0767
Family Caspase catalytic domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020857   Gene: ENSNLEG00000017162   Transcript: ENSNLET00000021900
Sequence length 431
Comment pep:known_by_projection supercontig:Nleu1.0:GL397280.1:30024334:30051794:-1 gene:ENSNLEG00000017162 transcript:ENSNLET00000021900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWKVAVFLSVALGIGAVPIDDPEDGGKHWVVIVAGSNGWYNYRHQTGACKVFFYKGPDK
ISEACHISFKLCPLIFSNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAE
AVRGKGSGKVLKSGPQDHVFVYFTDHGSTGILVFPNEDLHVKDLNETIHYMYKHKMYQKM
VFYIEACESGSMMNHLPDNINVYATTAANPRESSYACYYDEKRSTYLGDWYSVNWMEDSD
VEDLTKETLHKQYHLVKSHTNTSHVMQYGNKTISTMKVMQFQGMKHKASSPLSLPPVTHL
DLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDARHLIEKSVRKIVSLLAASEAG
VEQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRYLYVLVNLCEKPYPLHRIK
LSMDHVCLGHY
Download sequence
Identical sequences ENSNLEP00000020857 ENSNLEP00000020857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]