SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020884 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020884
Domain Number 1 Region: 543-894
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.02e-110
Family PDEase 0.00000222
Further Details:      
 
Domain Number 2 Region: 356-538
Classification Level Classification E-value
Superfamily GAF domain-like 5.23e-49
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 187-369
Classification Level Classification E-value
Superfamily GAF domain-like 4.36e-33
Family GAF domain 0.0000000198
Further Details:      
 
Domain Number 4 Region: 7-159
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000141
Family GAF domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020884   Gene: ENSNLEG00000017175   Transcript: ENSNLET00000021931
Sequence length 903
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:17687589:17880758:1 gene:ENSNLEG00000017175 transcript:ENSNLET00000021931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPQPCADSFQDALLSLGSVIDISGLQRAVKEALSAVLPRVGTVYTYLLDGESRLVCEDPL
HELPQEGKVREAIISRKRLGCNGLGFSDLPGKPLARLVAPLAPDTQVLVMPLADKEAGAV
AAVILVHCGQLSDNEEWSLQAVEKHTLVALRRVQALQQRGPREAPRAVQNPPEGAAEDQK
GGAAYTDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKV
IGDKVLGEEVSFPLTGCLGQVVEDKKSIQLKDLTSEDVQQLQSMLGCALQAMLCVPVISR
ATDQVVALACAFNKLEGDLFTDQDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQ
VAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIR
IPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVA
ELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVS
DDEYTKLLHDGIQPVAAIDCNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPT
LARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDL
DHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRML
DLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKT
TRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLF
PKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTGAPINGCCSL
DAE
Download sequence
Identical sequences ENSNLEP00000020884 ENSNLEP00000020884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]