SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020885 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020885
Domain Number 1 Region: 54-562
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 3.77e-191
Family Myeloperoxidase-like 0.00000000000000561
Further Details:      
 
Domain Number 2 Region: 13-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000196
Family EGF-type module 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020885   Gene: ENSNLEG00000017180   Transcript: ENSNLET00000021933
Sequence length 580
Comment pep:known_by_projection supercontig:Nleu1.0:GL397294.1:16457204:16474973:1 gene:ENSNLEG00000017180 transcript:ENSNLET00000021933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSMVADLHFSPTVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPGLWTWLRN
SLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWE
SFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNIMFAF
FAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGE
MYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEH
PTWGDEQLFQTTRLILIGETIRIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAME
FNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQSAGRIGGGRNM
DHHVLHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDA
LEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEMGFNIVK
TATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
Download sequence
Identical sequences ENSNLEP00000020885 ENSNLEP00000020885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]