SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020901 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020901
Domain Number 1 Region: 8-58
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000401
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 2 Region: 409-441
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000981
Family CCCH zinc finger 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020901   Gene: ENSNLEG00000017204   Transcript: ENSNLET00000021951
Sequence length 1190
Comment pep:known_by_projection supercontig:Nleu1.0:GL397294.1:16923991:16981805:-1 gene:ENSNLEG00000017204 transcript:ENSNLET00000021951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVQAAQWTEFLSCPICYNEFDENVHKPISLGCSHTVCKTCLNKLHRKACPFDQTAINTD
IDVLPVNFALLQLVGAQVPDHQSIKLSNLGENKHYEVAKKCVEDLALYLKPLSGGKGVAS
LNQSALSRPMQRKLVTLVNCQLVEEEGRVRAMRAARSLGERTVTELILQHQNPQQLSANL
WAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIG
HVVQLLYRASCFKVTKRDEDSSLMQLKEEFRSYEALRREHDAQIVHIAMEAGLRISPEQW
SSLLYGDLAHKSHMQSIIDKLQSPESFAKSVQELTIVLQRTGDPANLNRLRPHLELLANI
DPNPDAVSPTWEQLENAMVAVKTVVHGLVDFIQNYSRKGHETPQPQPNSKYKTSMCRDLR
QQGGCPRGTNCTFAHSQEELEKYRLRNKKINATVRTFPLLNKVGVNNTVTTTAGNVISVI
GGTETTGKIVPSTNGISNAENSVSQLISRSTDSTLRALETVKKVGKVGTNGQNAAGPSAD
SVTEKNGSPPKTPVSNVAATSAGPSNVGTELNSVPQKSSPFLTRVPVYPPHSENIQYFQD
PRTQIPFEVPQYPQTGYYPPLPTVPAGVAPCVPRFVRSNNVPESSLPPASMPYADHYSTF
SPRDRMNSSPYQPPPPQPYGPVPPVPSGMYAPVYDSRRIWRPPMYQRDDIIRSNSLPPMD
VMHSSVYQTSLRERYNSLDGYYSVACQPPSEPRTTVPLPREPCGHLKTSCEEQIRRKPDQ
WAQYHTQKAPLVSSTLPVATQSPTPPSPLFSVDFRADFSESVSGTKFEEDHLSHYSPWSC
GTIGSCINAIDSEPKDVIANSNAVLMDLDSGDVKRRVHLFETQRRTKEEDPIIPFSDGPI
ISKWGAISRSSRTGYHTTDPVQATASQGSATKPISVSDYVPYVNAVDSRWSSYGNEATSS
AHYIERDRFIVTDLSGHRKHSSTGDLLSLELQQAKSNSLLLQREANALAMQQKWNSLDEG
RHLTLNLLSKEIELRNGELQSDYTEDATDTKPDRDIELELSALDTDEPDGQSEPIEEILD
IQLGISSPNDQLLNGTAVENGHPVQQLQKEPAKQKKQSLGEDHVILEEQKTILPVTSCFS
QPLPVSISNASCLPITTSVSVGNLILKTHVMSEDKNDFLKPVANGKMVNS
Download sequence
Identical sequences ENSNLEP00000020901 ENSNLEP00000020901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]