SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020937 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020937
Domain Number 1 Region: 624-817
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-17
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 2 Region: 426-597
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-16
Family Laminin G-like module 0.028
Further Details:      
 
Domain Number 3 Region: 109-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000438
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 147-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000687
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 5 Region: 324-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000028
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 6 Region: 185-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000246
Family EGF-type module 0.006
Further Details:      
 
Domain Number 7 Region: 812-848
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000037
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 70-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000168
Family EGF-type module 0.013
Further Details:      
 
Domain Number 9 Region: 225-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000292
Family EGF-type module 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020937
Domain Number - Region: 368-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.028
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020937   Gene: ENSNLEG00000017244   Transcript: ENSNLET00000021990
Sequence length 880
Comment pep:known_by_projection supercontig:Nleu1.0:GL397294.1:17443042:17462607:1 gene:ENSNLEG00000017244 transcript:ENSNLET00000021990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALARPGTPDPQTVASVLLPLLLWAPALSLLTGTVPSEPPSACASDPCAPGTECQATESG
GYTCGPMEPRGCATQPCHHGALCVPQGSDPIGFRCYCVPGFQGPRCELDIDECASRPCHH
GATCRNLADRYECHCPLGYAGVTCETEVDECASAPCLHGGSCLDGVGSFRCVCAPGYGGT
RCQLDLDECQSQPCAHGGTCHDLVNGFRCDCADTGYEGMHCEQEVLECASAPCAHNASCL
EGLGSFRCLCWPGVCVQVCGLGRWGRCVAVRECPLGPRDQIRSFTAPLPTPESALFLGRV
SVSLAIEWTLSALPGSEGADCGVEMDECASRPCLNGGRCQDLPNGFQCHCPDGYTGVWGE
RDEDEGVSSPRLVGGECLGDTVAGYICRCPEWGGSDCSVQLTGCQGHTPAGCHCIPIFKS
GVHSYVCHCPPGTHGPFCGQNTTFSVMAGSPIQASVPAGGPLGLALRFRTTLPAGTLAIR
NDTKESLELALVAATLQATLWSHGTTVLVLRLPDLALNDGHWHQVEVVLHLATLELRLWH
EGCSAQLCVASGPVALASTASATLLPAGISSAQLGDVTFAGCLQDVHVDGHLLLPEDLGE
NVLLGCERREQCQPLPCVHGGSCVDLWTHFRCDCPRPHRGPTCADEIPAVTFGLGGAPSS
ASFLLQELPGPNLTVSFLLRTREPAGLLLQFANDSAAGLTVFLSEGRIRAEAPGSPAVVL
PGRWDDGLRHLVTLSFGPDQLQDLGQHVHVGGRLLAADSQPWGGPFRGCLQDLRLDGRHL
PFFSLPLDNSSQPSELSGRQSWNLTAGCISEDMCSPSPCFNGGTCLVTWNDFHCTCPANF
TGPTCAQQLWCPGQPCLPPATCEEVPDGFVCCLSHPRSAA
Download sequence
Identical sequences ENSNLEP00000020937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]