SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020956 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020956
Domain Number 1 Region: 409-540
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000001
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020956   Gene: ENSNLEG00000017254   Transcript: ENSNLET00000022009
Sequence length 562
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:55147100:55153149:-1 gene:ENSNLEG00000017254 transcript:ENSNLET00000022009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHDLASLMPAPKSLGSAFKSWRLDKAPSPQHTFPSTSIPGMAFALLASVPPVFGLYTSF
FPVLIYSLLGTGRHLSTGTFAILSLMTGSAVERLVPEPLVGNLSGIEKEQLDAQRVGVAA
AMAFGSGALMLGMFVLQLGVLSTFLSEPVVKALTSGAALHVFVSQLPSLLGLLPRQIGCF
SLXXTLAAVLTALPPSSPAELTISALSLELLVPVKELNVRFRDRLLTPIPGEVVLVRMAV
LLCFTSSLDTRYHVQIVGLLPGGFPQPLLPNLAELPRILADLLPIALVTVVVSASLASIY
ADKYSYTIDSNQELLAHGASNLISSLFSCFPNSATLATTSLLVDAGGKTQLAGLFSCIVV
LSVLLWLGPFFYYLPKAVLACINISSMRQMFCQMQELPQLWHISQTTMLLQVPGLCILSY
PTPLYFETCGQFRCNLEWHLGLGEGEKETSKPDGPTVAVAEPVRVVVLDFSGVTFADAAG
AREVVEVRERLASQCRDARIRLLLAQCNASVLGTLTRAGLLDRVTPDQLFVSVQDAAAYA
LGSLVRGSSARSGSQEALGCGK
Download sequence
Identical sequences ENSNLEP00000020956 ENSNLEP00000020956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]