SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020969 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020969
Domain Number 1 Region: 217-287
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000146
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020969   Gene: ENSNLEG00000017264   Transcript: ENSNLET00000022022
Sequence length 327
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:18442932:18510092:-1 gene:ENSNLEG00000017264 transcript:ENSNLET00000022022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVEVEVGGGAAGERELDEVDMSDLSPEEQWRVEHARMHAKHRGHEAMHAEMVLILIA
TLVVAQLLLVQWKQRHPRSYNMVTLFQMWVVPLYFTVKLHWWRFLVIWILFSAVTAFVTF
RATRKPLVQTTPRLVYKWFLLIYKISYATGIVGYMAVMFTLFGLNLLFKIKPEDAMDFGI
SLLFYGLYYGVLERDFAEMCADYMASTIGFYSESGMPTKHLSDSVCAVCGQQIFVDVSEE
GIIENTYRLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLKRMFSNPWERPHVMYGQLL
DWLRYLVAWQPVIIGLVQGINYILGLE
Download sequence
Identical sequences A0A096MMB2 A0A0D9QW22 A0A2I3HRX1 A0A2K5JCC7 A0A2K5VE00 A0A2K6AEM6 A0A2K6AS20 A0A2K6LY41 A0A2K6N8R2 F7EE81 M3W3V2
ENSNLEP00000020969 ENSPANP00000000735 ENSNLEP00000020969 NP_001181544.1.72884 XP_003780984.1.62490 XP_003992824.1.62641 XP_007080972.1.5354 XP_008018193.1.81039 XP_010365225.1.97406 XP_011717194.1.29376 XP_011812158.1.43180 XP_011849091.1.47321 XP_012600403.1.48125 XP_014697478.1.49734 XP_014970528.1.72884 XP_017749828.1.44346 XP_019305213.1.44245 ENSMMUP00000009604 9544.ENSMMUP00000009604 ENSMMUP00000009604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]