SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020976 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020976
Domain Number 1 Region: 155-216
Classification Level Classification E-value
Superfamily RING/U-box 1.2e-16
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020976
Domain Number - Region: 139-150
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0238
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020976   Gene: ENSNLEG00000017271   Transcript: ENSNLET00000022030
Sequence length 347
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:55164135:55169428:-1 gene:ENSNLEG00000017271 transcript:ENSNLET00000022030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFVLSRMAACGGTCKNKVTVSKPVWDFLSKETPARLARLREEHRVSILIDGETSDIYVL
QLSPQGPPPAPPNGLYLARKALKGLLKEAEKELKKAQRQGELMGCLALGGGGEHPEMHRT
GPPPLRAAPLLPPGARGLPPPPPPLPPPLPPRLREEAEEQESTCPICLGEIQNAKTLEKC
RHSFCEGCITRALQVKKACPMCGRFYGQLVGNQPQNGRMLVSKDATLLLPSYEKYGTIVI
QYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTLFRKAFDQRLTFTIGTSMTT
GRPNVITWNDIHHKTSCTGGPQLFGYPDPTYLTRVQEELRAKGITDD
Download sequence
Identical sequences G1S638
XP_003252813.1.23891 XP_012365772.1.23891 ENSNLEP00000020976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]