SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020979 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020979
Domain Number 1 Region: 364-678
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.35e-55
Family Integrin alpha N-terminal domain 0.0000467
Further Details:      
 
Domain Number 2 Region: 196-389
Classification Level Classification E-value
Superfamily vWA-like 8.75e-44
Family Integrin A (or I) domain 0.0000348
Further Details:      
 
Domain Number 3 Region: 828-959
Classification Level Classification E-value
Superfamily Integrin domains 1.05e-19
Family Integrin domains 0.016
Further Details:      
 
Domain Number 4 Region: 678-824
Classification Level Classification E-value
Superfamily Integrin domains 0.000000518
Family Integrin domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020979   Gene: ENSNLEG00000017274   Transcript: ENSNLET00000022033
Sequence length 1178
Comment pep:known_by_projection supercontig:Nleu1.0:GL397423.1:1842443:1921788:-1 gene:ENSNLEG00000017274 transcript:ENSNLET00000022033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLFHALLCMASLALLAAFNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRT
KRTPGPLHRCSLVQDEIICHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRKPHSLSS
ELTGTCTLLGPDLRPQAQANFFDLENLLDPDTRADTGDCYSNKEGGGGEDANTARRRRAL
EKEEEEDKEEEEDEEEEEAGTEIAIILDGSGSIDPPDFQRAKDFISNMMRNFYEKCFECN
FALVQYGGVIQTEFDLRDSQDVMASLARVQNITQVGSVTKTASAMQHVLDSIFTSSHGSR
RKASKVMVVLTDGGIFEDPLDLTTVINSPKMQGVERFAIGVGEEFKSARTERELNQIASD
PNETHAFKVTNYMALDGLLSKLRHNIISMEGTVGDALHYQLAQIGFSAQILDERQVLLGA
VGAFDWSGGALLYDTRSRRGHFLNQTAAAVADAEAAQYSYLGYAVAVLHKTCSLSYVAGA
PRYKHHGAVFEFQKEGREASSLPVLEGEQMGSYFGSELCPVDIDMDGTTDFLLVGAPFYH
VHGEEGRVYVYRLSEQDGSFSLARILSGHPGFTNARFGFAMAAMGDLSQDKLTDVAIGAP
LEGFWTDDGASFGSVYIYNGHWDGLSASPSQRIRASTVAPGLQYFGMSMAGGFDISGDGL
ADITVGTLGRAVVFRSRPVVRLKVSMAFTPSTLPIGFNGVVNVSLCFEISSVTTASESGL
RGASLNFTLDVDVGKQRRRLQCSDVRSCLGCLREWSSGSQLCEDLLLMPTEGEVCEEDCF
SNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVS
QVXXXXXXXXXXXNISLTNSEEDSYMTSMALNYPRNLQFKRMQKPPSPSIHCDDPQPVAS
VLIMNCRIGHPVLKRSSAHVSVVWQLEENAFPNRTADITVAVTNSNERRSLANETHTLQF
RHAFVAVLSKPSIMYVNTGQGLSHYKEFLFHIHGENLFGAEYQLQICIPTKLRGLQIVTV
KNLTRTQASTVCSWSQERACGYSPVQHVEEWHSVSCVIASDKENVTMAAEISLDHSEELL
KDVTELQILGEISFNKSLYEGLNAENHRTRISVVFLKDEKYHSLPVIIKGSVGGLLVLIV
ILVILFKCGFFKRKYQQLNLESIRKAQLKSENLLEEEN
Download sequence
Identical sequences ENSNLEP00000020979 ENSNLEP00000020979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]