SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021062 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021062
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 5.24e-54
Family Globins 0.000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021062   Gene: ENSNLEG00000026827   Transcript: ENSNLET00000022127
Sequence length 147
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:19801420:19802904:-1 gene:ENSNLEG00000026827 transcript:ENSNLET00000022127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLTPEEKSAVTALWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK
VKAHGKKVLGAFSDGLAHLDNLKGTFAQLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG
KEFTPQVQAAYQKVVAGVANALAHKYH
Download sequence
Identical sequences G1S6C3
ENSNLEP00000021062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]