SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021073 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021073
Domain Number 1 Region: 787-1034
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.59e-77
Family Eukaryotic proteases 0.0000664
Further Details:      
 
Domain Number 2 Region: 453-574
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.54e-36
Family Frizzled cysteine-rich domain 0.00015
Further Details:      
 
Domain Number 3 Region: 137-249
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.31e-30
Family Frizzled cysteine-rich domain 0.00069
Further Details:      
 
Domain Number 4 Region: 578-616
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 654-698
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 6 Region: 342-380
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 383-424
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 269-306
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000011
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 306-342
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 620-652
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000107
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 11 Region: 711-790
Classification Level Classification E-value
Superfamily SRCR-like 0.0000327
Family Hepsin, N-terminal domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021073   Gene: ENSNLEG00000017357   Transcript: ENSNLET00000022141
Sequence length 1042
Comment pep:known_by_projection supercontig:Nleu1.0:GL397274.1:38649038:38903384:-1 gene:ENSNLEG00000017357 transcript:ENSNLET00000022141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQSPALAPEECYRRAGSPKPVLIADDNNMGNGCSQKLATANLPRFLMLVLIPCICALVL
LLVTLLSCVGTLQKVYFKSNGSEPLVTDGEIQRSDVFLTNTIYNQSTVVSTAHPDQHVPA
WTMDASLPGDQSHRNTSACMNITHNQCHMLPYHSTLTPLLSVVRNMEMEKFLRFFTYLHR
LSCYQHVMLFGCSLAFPECIIDGDDSHGLLPCRSFCEAAKEGCESVLGMVNYSWPDFLKC
SQFRNQTESSNVSRICFSPQQENGKQLLCGRGESFLCASGICVPRKLQCNGYNDCDDWSD
EAHCNCSENLFHCHTGKCLDYSLVCDGYDDCGDLSDEQNCDCNPTTEHRCGDGRCIAMEW
VCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIHTP
CQEGDQRCLYNPCLDSCGGSSLCDLNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHR
TQKEASISWESSLFPALVQTNCYKYLMFFACTILVPKCDVNTGQLIPPCRALCEHSKERC
ESVLGIVGLQWPEDTDCSQFPEENSDNQNCLMPDEYVEECSPSHFKCRSGRCVLASRRCD
GQADCDDDSDEENCGCKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDEL
ECANHACVSRDLWCDGKADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADGWQE
MLSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWEILNGTTLHELLVNGQSCQSRSK
ISLLCTKQDCGRRFAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLT
VAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSQAVVDYDISIVELSE
DINETGYVRPVCLPSPEQWLEPDTYCYITGWGHMGSKMPFKLQEGEVRIISLEHCQSYFD
MKTITTRMICAGYEFGTVDSCMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVY
SNVSYFVEWIKRQIYIQTFLLN
Download sequence
Identical sequences G1S6D4
ENSNLEP00000021073 ENSNLEP00000021073 XP_003258465.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]