SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021151 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021151
Domain Number 1 Region: 120-318
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.93e-70
Family Arfaptin, Rac-binding fragment 0.0000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021151   Gene: ENSNLEG00000017423   Transcript: ENSNLET00000022226
Sequence length 341
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:21034382:21039810:-1 gene:ENSNLEG00000017423 transcript:ENSNLET00000022226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGD
GLIPTGSGRHPSHSTTPAGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSR
TVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQE
EFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRT
DLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLL
FHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ
Download sequence
Identical sequences A0A096N1J3 A0A0D9QWC9 A0A1D5RK09 A0A2J8SVP2 A0A2K5E0V9 A0A2K5MCH1 A0A2K6DVQ6 A0A2K6M6X0 A0A2K6Q9P9 A0A2K6U316 F6ZCJ2 G1S6L2 G7PQV7
NP_001270205.1.63531 XP_002754993.1.60252 XP_002754994.3.60252 XP_003254906.2.23891 XP_003254907.1.23891 XP_003919825.2.74449 XP_008006812.1.81039 XP_008006820.1.81039 XP_010381835.1.97406 XP_010381836.1.97406 XP_011751300.1.29376 XP_011751301.1.29376 XP_011827885.1.47321 XP_011827886.1.47321 XP_011891835.1.92194 XP_011891836.1.92194 XP_012312181.1.9421 XP_014970459.1.72884 XP_014970460.1.72884 XP_015289593.1.63531 XP_017749126.1.44346 XP_017749127.1.44346 XP_017749128.1.44346 ENSMMUP00000010152 ENSMMUP00000010152 ENSPANP00000006167 ENSNLEP00000021151 9544.ENSMMUP00000010152 ENSCJAP00000025886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]