SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021203 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021203
Domain Number 1 Region: 1092-1214
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-33
Family Cadherin 0.00068
Further Details:      
 
Domain Number 2 Region: 1842-1966
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-31
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 1636-1742
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-30
Family Cadherin 0.0015
Further Details:      
 
Domain Number 4 Region: 242-363
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-29
Family Cadherin 0.0018
Further Details:      
 
Domain Number 5 Region: 464-569
Classification Level Classification E-value
Superfamily Cadherin-like 6.54e-28
Family Cadherin 0.0019
Further Details:      
 
Domain Number 6 Region: 2159-2280
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-27
Family Cadherin 0.0023
Further Details:      
 
Domain Number 7 Region: 2594-2698
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-25
Family Cadherin 0.0018
Further Details:      
 
Domain Number 8 Region: 1539-1641
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-25
Family Cadherin 0.0034
Further Details:      
 
Domain Number 9 Region: 1744-1854
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-24
Family Cadherin 0.0019
Further Details:      
 
Domain Number 10 Region: 2363-2479
Classification Level Classification E-value
Superfamily Cadherin-like 4.19e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 11 Region: 565-672
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-24
Family Cadherin 0.00069
Further Details:      
 
Domain Number 12 Region: 2475-2594
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-23
Family Cadherin 0.0024
Further Details:      
 
Domain Number 13 Region: 882-992
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-22
Family Cadherin 0.0061
Further Details:      
 
Domain Number 14 Region: 2698-2803
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 15 Region: 1204-1311
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-21
Family Cadherin 0.0013
Further Details:      
 
Domain Number 16 Region: 678-779
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-20
Family Cadherin 0.0014
Further Details:      
 
Domain Number 17 Region: 349-476
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-19
Family Cadherin 0.0036
Further Details:      
 
Domain Number 18 Region: 135-246
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-18
Family Cadherin 0.0045
Further Details:      
 
Domain Number 19 Region: 1429-1537
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-16
Family Cadherin 0.00084
Further Details:      
 
Domain Number 20 Region: 2270-2375
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-16
Family Cadherin 0.003
Further Details:      
 
Domain Number 21 Region: 996-1096
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-16
Family Cadherin 0.0028
Further Details:      
 
Domain Number 22 Region: 786-885
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-16
Family Cadherin 0.0042
Further Details:      
 
Domain Number 23 Region: 1947-2086
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000111
Family Cadherin 0.0084
Further Details:      
 
Domain Number 24 Region: 2065-2162
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000186
Family Cadherin 0.0019
Further Details:      
 
Domain Number 25 Region: 2800-2870
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000542
Family Cadherin 0.0031
Further Details:      
 
Domain Number 26 Region: 48-134
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000214
Family Cadherin 0.0064
Further Details:      
 
Domain Number 27 Region: 1362-1435
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000107
Family Cadherin 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021203   Gene: ENSNLEG00000017465   Transcript: ENSNLET00000022278
Sequence length 3297
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:21194670:21216926:-1 gene:ENSNLEG00000017465 transcript:ENSNLET00000022278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKELGVVPSCPGMKSPRPRLLLPLLLLLLLLGAGVPGAWGQAGSLDLQIDEEQPAGTLI
GDISAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQRDRYRFTAVT
PDGATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGYA
LSGDGAGETFRLETRPGPDGAPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQALL
DVTLLDINDHAPAFNQSRYHAVVSESLGPGSPVLQVFASDADAGVNGAVTYEINRRQSEG
DGPFFIDAHTGLLRLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPS
MTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVI
YLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDHHLYRPEP
LPEVALPGSFVVRVTARDPDQGTNGQVTYSLVPGAHSHWFSIDPTSGIITTAASLDYELE
PQPQLTVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVT
ATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVD
GGGLKSMVYVKVFLSDENDNPPQFYPREYAASISVQSPPGTAVLRLRAHDPDQGSHGRLS
YHILAGNSPPLFALDEQSGLLTVAWPLARRANSVVQLEIGAQDGGGLQAEPSARVNISIV
PGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLDA
VSGLLQTLRPLDRELLGPVLELEVRAGSGMPPAFAIARVRVLLDDVNDNSPAFPAPEDTV
LLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTAGHVRLMRPLGPSGG
PAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVLQ
VQAQAPDGGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYVLKVMAVSGSKAE
LGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLT
YSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVAV
LDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGS
ELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEPP
PDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAPPEPAGVSALTYTLVGGADPEGTFAL
DAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVRVQDENEHAPAFARDPL
ALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGL
DRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPPG
PAALHVVARDPDLGEAARVSYWLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVA
SDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENSPPGTSLLTLRATDPDVGAN
GQVTYGGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVAV
EDENDHAPTFGSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVLD
FTSGEFGTMRPLDREVEPAFQLRIEARDGGHPALSATLLLTVTVLDANDHAPAFPVPAYS
VEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTATALDREQ
CPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTL
ALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFVVAT
DLGRPARSATGVIIVGLQGEAERGPRFPRASSEAIIRENAPPGTPIVSPRAIHAGGTNGP
ITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVLTLTL
QDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFH
VDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQPW
ELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQ
CDRYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSAT
DRDSGANGHISYHLASPASGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAPG
RAARATVHVQLQDQNDHAPSFTLPHYHVAVTEDLPPGSTLLTLEATDADGSRTHAAVDYS
IISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQPP
QSSVVPVTVTVLDVNDNPPVFTRASYRVAVPEDTPVGAELLHVEASDADPGPHGLVRFTV
SSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQDVND
HGPAFPLNLLSTSLAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFALN
SSTGELRARVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPAFHFQ
VPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYLRVDSRAPGSGT
ATSGGGGRTRREAPRELRLEVIARGPLPGSRSATVPVTVDITHTALGLAPDLNLLLVGAV
AASLGVVVVLALAALVLGLVRARSRKAEAAPGPMSQTAPLASGSLQKLGREPPSPPPSEH
LYHQTLPSYGGPGAGGPYPRGGSLDPSHSSGRGSAEAAEDDEIRMINEFPRVASVASSLA
ARGPDSGIQQDADGLSDTSCEPPAPDTWYKGRKAGLLLPGAGATLYREEGPPATATAFLG
GCGLSPAPTGDYGFPADGKPCVAGALTAIVAGEEELRGSYNWDYLLSWCPQFQPLASVFT
EIARLKDEARPCPPAPRIDPPPLITAVAHPGAKSVPPKPANTAAARAIFPPASHRSPISH
EGSLSSAAMSPSFSPSLSPLAARSPVVSPFGVAQGPSASALSAESGLEPPDDTELHI
Download sequence
Identical sequences G1S6R4
ENSNLEP00000021203 XP_003254918.1.23891 ENSNLEP00000021203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]