SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021249 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021249
Domain Number 1 Region: 12-308
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.23e-82
Family Eukaryotic proteases 0.00051
Further Details:      
 
Domain Number 2 Region: 440-552
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-29
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Domain Number 3 Region: 327-429
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-22
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021249   Gene: ENSNLEG00000017505   Transcript: ENSNLET00000022327
Sequence length 571
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:22250155:22266974:-1 gene:ENSNLEG00000017505 transcript:ENSNLET00000022327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHGKTMSLKMLISRNKLILLLGIVFFEQGKSATVSLPKAPSCGQSLVKVQPWNYFNIFSR
ILGGSQVEKGSYPWQVSLKQRQKHICGGSIVSPQWVITAAHCVANRNIVSTLNVTAGEYD
LSQTEPGEQTLTIETVIIHPHFSTKKPMDYDIALLKMAGAFQFDHFVGPICLPELQEQFE
AGFICTTAGWGRLTEDGVLSQVLQEVNLPILTWEECVAALLTLKRPISGKTFLCTGFPDG
GRDACQGDSGGSLMCRNKKGAWTLAGVTSWGLGCGRGWRNNVRKNDQGSPGIFTDLSKVL
PWIHEHIQTGNRRKSSRAWCGEQDVIVSGAEGELHFPESLHLYYESKQRCVWTLLVPEEM
HVLLSFSHLDVESCHHNYLSMYSLEDRPIGKFCGESLPSSILVGSNSLRLKFVSDATDYA
AGFNLTYKALKPNYIPGSGCSYLTVLFEEGLIQSLNYPENYSDMAHCDWIFQAPKHHLIK
LSFQSLEIEESGDCTSDYVTVHSDVERKKEIARLCGYDVPTPVLSPSSIMLISFQSDENG
TFRGFQATVSFIPKADLNISISEDESVFLET
Download sequence
Identical sequences ENSNLEP00000021249 ENSNLEP00000021249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]