SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021250 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021250
Domain Number 1 Region: 6-90
Classification Level Classification E-value
Superfamily DEATH domain 2e-18
Family Pyrin domain, PYD 0.0078
Further Details:      
 
Domain Number 2 Region: 165-366
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000184
Family Nucleotide and nucleoside kinases 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021250   Gene: ENSNLEG00000017509   Transcript: ENSNLET00000022329
Sequence length 702
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:22451252:22456713:-1 gene:ENSNLEG00000017509 transcript:ENSNLET00000022329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMAKARNPREALLWALSDLEENDFKKLKFYLRDMTLSEGQPPLARGELGGLIPVDLAEL
LISKYGEKEAVKVVLKGLKVMNLLELVDQLSHICLHDYREIYREHVCCLEEWQEAGVNGR
YNQVLLVAKPSSESPESLACPIPEQELDSVMVEALFDSGEKPSLAPSLVVLQGSAGTGKT
TLARKMVLDWATGTLYPGRFDYVFYVSCKEVVLLLESKLEQLLFWCCGDNQAPVTEILRQ
PERLLFILDGFDELQRPFEEKLKKRGLSPKESLLHLLIRRHTLPTCSLLITTRPLALRNL
EPLLKQARHVHILGFSEEERARYFSSYFTDEKQAARAFDIVQKNDILYKACQIPGICWVV
CSWLKGQMERGKVVLETPRNSTDIFMAYVSTFLPPDDDGGCSELSRHRVLRSLCSLAAEG
IQHQRFLFEEAELRKHNLDGPRLAAFLSSNDYQLGLAIKKFYSFRHISFQDFFHAMSYLV
KEDQSRLGKGSRREVQRLLEVKEQERNDEMTLTMQFLLDISKKDSFSNLELKFCFRISPC
LAQDLKHFKEQMESMKHNRTWDLEFSLYEAKIKNLVKGIQMNNVSFKIKHSNEKKSQSQN
LFSIKSSLSHRPKKEQKCPSVHGQKEGKDNIAGTQKEASTGKGRGTEEADEEVRYSGMGS
RETGTITLKGWRNEGVKGQTGRWGKTDKVKKDGERRIKTNGY
Download sequence
Identical sequences ENSNLEP00000021250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]