SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021306 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021306
Domain Number 1 Region: 769-877
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-25
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 2 Region: 280-399
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.65e-18
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 4-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.57e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 242-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000868
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 582-618,647-762
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000012
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 173-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000267
Family EGF-type module 0.026
Further Details:      
 
Domain Number 7 Region: 133-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000246
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021306   Gene: ENSNLEG00000017553   Transcript: ENSNLET00000022387
Sequence length 955
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:23553288:23634751:-1 gene:ENSNLEG00000017553 transcript:ENSNLET00000022387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCEDIDECGNELNGGCVHDCLN
IPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNIMGSYECCCKEGFFLSDNQ
HTCIHRSEEGLSCMNKDHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGC
QHSCEDTANGPECSCHPQYKMHTDGRSCLEREDTALEVTESNATSVVDGDKRVKRRLLME
TCAVNNGGCDRTCKDTSTGVHCSCPVGFTLQLDGKTCKDIDECQTRNGGCDHFCKNTVGS
FDCSCKKGFKLLTDEKSCQDVDECSLDRTCDHSCINHPGTFACACNRGYTLYGFTHCGDT
NECSVNNGGCQQVCVNTVGSYECQCHPGYKLHWNKKDCVEVKGLLPTSVSPRVSLHCGKS
GGGDGCFLRCHSGIHLSSDVASIRTSVTFKLNEGKCSLKKAELFPEGLRPALPEKHSSVK
ESFRYVNLTCSSGKQVPGAPGRPSAPKEMFITVEFELETNQKEVTASCDLSCIVKRTEKR
LRKAIRTLRKAVHREQFHLQLSGTNLDVAKKPPRTSERQAESCGVGQGHVENQCVSCRAG
TYYDGAQERCILCPNGIFQNEEGQITCEPCSRPGNSGALKTPEAWNVSECGGLCQPGEYS
ADGFAPCQLCALGTFQPEAGRTSCFPCGGGLPTKHQGATSFQDCETRVQCSPGHFYNTTT
HRCIRCPVGTYQPEFGKNNCVSCPGNTTTDFDGSTNITQCKNRRCGGELGDFTGYIESPN
YPGNYPANTECTWTINPPPKRRILIVVPEIFLPIEDDCGDYLVMRKTSSSNSVTTYETCQ
TYERPIAFTSRSKKLWIQFKSNEGNSARGFHVPYVTYDEDYQELIEDIVRDGRLYASENH
QEILKDKKLIKALFDVLAHPQNYFKYTAQESREMFPRSFIRLLRSKVSRFLRPYK
Download sequence
Identical sequences ENSNLEP00000021306 ENSNLEP00000021306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]