SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021313 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021313
Domain Number 1 Region: 706-977
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-67
Family Protein kinases, catalytic subunit 0.000000026
Further Details:      
 
Domain Number 2 Region: 322-514
Classification Level Classification E-value
Superfamily L domain-like 3.4e-49
Family L domain 0.000000103
Further Details:      
 
Domain Number 3 Region: 28-204
Classification Level Classification E-value
Superfamily L domain-like 8.22e-46
Family L domain 0.000000175
Further Details:      
 
Domain Number 4 Region: 499-629
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.32e-22
Family Growth factor receptor domain 0.0000000385
Further Details:      
 
Domain Number 5 Region: 179-332
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.24e-19
Family Growth factor receptor domain 0.0000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021313   Gene: ENSNLEG00000017554   Transcript: ENSNLET00000022394
Sequence length 1342
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:56721595:56745305:-1 gene:ENSNLEG00000017554 transcript:ENSNLET00000022394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFIM
LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG
RSCPPCHEVCKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLSVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLG
GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGLGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEDD
NLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPR
PVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPRPHGDSAYHSQRHSLL
TPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
NRRRRHSPPHPPRPGSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTADEDY
EYMNRQRGGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATD
SAFDNPDYWHSRLFPKANAQRT
Download sequence
Identical sequences G1S724
ENSNLEP00000021313 XP_003252875.1.23891 XP_012365819.1.23891 ENSNLEP00000021313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]