SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021334 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021334
Domain Number 1 Region: 126-304
Classification Level Classification E-value
Superfamily PH domain-like 7.67e-38
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 
Domain Number 2 Region: 4-75,108-171
Classification Level Classification E-value
Superfamily EF-hand 0.000000289
Family Calbindin D9K 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021334   Gene: ENSNLEG00000017577   Transcript: ENSNLET00000022417
Sequence length 584
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:24164784:24249404:1 gene:ENSNLEG00000017577 transcript:ENSNLET00000022417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLKDELLKAIWHAFTALDQDHSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDD
EGPVSNQGYMPYLNRFILEKVLTFFWVQHCLVCISLGNKKVVYYYLLVSTNKVYKKLVLL
QHIFKADKYPLIIVSEEVEYLLKKLTEAMGGGWQQEQFEDYKINFDDSKNGLSAWELIEL
IGNGQFSKGMDRQTVSMAINEVFNELILDVLKQGYMMKKGHRRKNWTERWFVLKPNIISY
YVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLVKCFDKTFEISASDKKKKQEWIQAI
HSTIHLLKLGSPPPHKEARQRRKELRKKQLAEQEELERQMKELQAANESKQQELEAVRKK
LEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRE
LEDMYLKLQEALEDERQARQDEETVRKLQARLLEEESSKRAELEKWHLEQQQAIQTTEAE
KQELENQRVLKEQALQEAMEQLEQLELERKQALEQYEEVKKKLEMATNKTKSWKDKVAHH
EGLIRLIEPGSKNPHLITNWGPAAFTEAELEEREKNWKEKKTTE
Download sequence
Identical sequences ENSNLEP00000021334 ENSNLEP00000021334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]