SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021359 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021359
Domain Number 1 Region: 149-195
Classification Level Classification E-value
Superfamily RING/U-box 1.5e-16
Family RING finger domain, C3HC4 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021359   Gene: ENSNLEG00000017598   Transcript: ENSNLET00000022443
Sequence length 230
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:25043949:25071069:-1 gene:ENSNLEG00000017598 transcript:ENSNLET00000022443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQQISDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHL
LFEVQPGSDSSAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQ
SSTSEEPDENSSSVTSCQASLWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDK
WSDRHRNCPICRLQMTGANESWVVSDAPTEDDMANYILNMADEAGQPHRP
Download sequence
Identical sequences A0A096N839 A0A0D9QX07 A0A2J8UPW6 A0A2K5JAR3 A0A2K5P2G6 A0A2K5XNX6 F7AVV4 G1S770 G3QKU0 G7PQQ9 K7CFP4 Q5R7K8 Q8WVD5
ENSNLEP00000021359 ENSMMUP00000020744 ENSP00000265981 9544.ENSMMUP00000020744 9606.ENSP00000265981 ENSPANP00000008764 ENSNLEP00000021359 ENSMMUP00000020744 gi|21361493|ref|NP_057506.2| NP_001126318.1.23681 NP_001253414.1.72884 NP_057506.2.87134 NP_057506.2.92137 XP_003254984.1.23891 XP_003818207.1.60992 XP_004050751.1.27298 XP_005578682.1.63531 XP_008005118.1.81039 XP_011803023.1.43180 XP_011803024.1.43180 XP_011825312.1.47321 XP_011825313.1.47321 XP_011937159.1.92194 XP_011941411.1.92194 XP_012360576.1.23891 XP_014970230.1.72884 XP_508282.2.37143 ENSP00000265981 ENSGGOP00000003075 ENSP00000265981 ENSGGOP00000003075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]