SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021362 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021362
Domain Number 1 Region: 29-177
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-38
Family Link domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021362   Gene: ENSNLEG00000017602   Transcript: ENSNLET00000022446
Sequence length 322
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:25088377:25099452:-1 gene:ENSNLEG00000017602 transcript:ENSNLET00000022446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARCPSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANLQLNFTEAKEA
CRLLGLTLASKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPV
SRQFAAYCYNSSDTWTNSCIPEIITTKDPTFNIQTATHTTEFIVSDSTYSVVSPYSTIPA
PTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFENEAAGFGGVPTAL
LVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKT
DKNPEEPKSPSKTTVRCLEAEV
Download sequence
Identical sequences G1S773
ENSNLEP00000021362 ENSNLEP00000021362 XP_003254985.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]