SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021371 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021371
Domain Number 1 Region: 34-201,258-465
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.8e-56
Family Integrin alpha N-terminal domain 0.0000145
Further Details:      
 
Domain Number 2 Region: 623-807
Classification Level Classification E-value
Superfamily Integrin domains 1.73e-39
Family Integrin domains 0.0009
Further Details:      
 
Domain Number 3 Region: 466-583
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000000387
Family Integrin domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021371   Gene: ENSNLEG00000017610   Transcript: ENSNLET00000022455
Sequence length 948
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:57101268:57124738:1 gene:ENSNLEG00000017610 transcript:ENSNLET00000022455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGARSRDPWGASGICYLFGSLLVELLFSRAVAFNLDVMGALRKEGEPSSLFGFSVALHR
QLQPRPQSWESPHPPRVAMPEPQIPFTTCAHRYEARQRVDQILETRDMIGRCFVLSQDLA
IRDELDGGEWKFCEGRPQGHEQFGFCQQGTAAAFSPDNHYLLFGAPGTYNWKGTARVELC
AQGSADLAHLDDGPYEAGGEKEQDPRLIPVPANSYFGRDLSPAQNCSNPLLLSLVLPLHA
PILLSLSCDLALNLLRGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVILRKDSASRLVP
EVLLSGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVYVYLNQGGHWAG
ISPLRLCGSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHGSSLGVVAKPSQ
VLEGEAVGIKSFGYSLSGSLDMDGNQYPDLLVGSLADTAVLFRARPILHVSHEVSIAPRS
IDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVMFLS
RNPEEPKHQASGTHDRVCGDAMFQLQVDTDPLTSEAASSQANSCLLLRPTHVPVPDAHTC
PCPLTRISEQELHPVSARARVFIELPLSIAGMAIPQQLFFSGVVRGERAMQSERDVGSKV
KYEVTVSNQGQSLKTLGSAFLNIMWPHEIANGKWLLYPMRVELEGGQGPGQKGLCSPRPN
ILHLDVDSRDRRRRELEPPEQQEPGEQQEPSMSWWPVSSAEKKKNITLDCARGTANCVVF
SCPLYSFDRAAVLHVWGRLWNSTFLEVRIPLGLYVSVQGYILTLVCKGQHGIIPEMQGTR
KPFSSSGGYPWSCLLDALLVSLTGPQLFRLLMMGFFKRAKHPEATVPQYHAVKIPREDRQ
QFKEEKTGTILRNNWGSPRREGPDAHPILAADGHPELGPDGHPGPGTA
Download sequence
Identical sequences ENSNLEP00000021371 ENSNLEP00000021371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]