SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021381 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021381
Domain Number 1 Region: 2010-2178
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-22
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 2 Region: 1740-1852
Classification Level Classification E-value
Superfamily CalX-like 4.19e-20
Family CalX-beta domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021381
Domain Number - Region: 390-427
Classification Level Classification E-value
Superfamily Purple acid phosphatase, N-terminal domain 0.0112
Family Purple acid phosphatase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021381   Gene: ENSNLEG00000017613   Transcript: ENSNLET00000022467
Sequence length 2179
Comment pep:known_by_projection supercontig:Nleu1.0:GL397279.1:27052763:27195270:1 gene:ENSNLEG00000017613 transcript:ENSNLET00000022467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSLSWGAANALLLVLLLAWASSTFISINRGVRVMKGHSAFLSGDDLKFAIPKEKDACKV
EVVMNEPITQRVGKLTPQVFDCHFLPNEVKYVHNGCPILDEDTVKLRLYRFTETDTFIET
FILWVYLLEPDCNIIRMSNNVLEVPEFNGLSQAIDKNLLRFDYDRMASLECTVSLDSART
RLPAHGQMVLGEPRPEEPRGDQPHSFFPESQLGAKLKCPGGSCTPGLKKIGSLKVSCEEF
LLMGLRYQHLDPPSPNIDYISIQLDLTDTRSKTVYKSESAWLPVYIRAGIPNQIPKAAFM
AMFILEVDQFILTSLTTSVLDCEEDETPKPLLVFNITKAPLQGYVTHLLDHTRPISSFTW
KDLSDMQIAYQPPNSSHSERRHDEVELEVYDFFFERSAPMTVHISIRTADTNAPRVSWNT
GLNLLEGQSRAITWEQFQVVDNDDIGAVRLVTVGGLQHGWLTLRGGKGFLFTVADLQAGV
VRYHHDDSDSTKDFVVFRIFDGHHSIRHKFPINVLPKDDSPPFLITNVVIELEEGQTILI
QGSMLRASDVDASDDYIFFNITKPPQAGEIMKKPGPGLIGYPVPGFHQRDLFNGIIYYRH
FGGEIFEDSFQFVLWDSHEPPNLSVPQVATIHITPVDDQLPKEAPGVSRHLVVKETEVAY
ITKKQLHFIDTESYDRELVYTITTPPFFSFSHRHLDAGKLFMVDSIPKVVKNPTALELRS
FTQHAVNYMKVAYMPPMQDIGPHCRHVQFTFSVSNQHGGTLHGICFNITILPVDNQVPEV
FTNPLKVTEGGQSVISTEHILISDADTKLDNIDLSLRGLPLHGRVDLNGFPLNSGGTFSW
GDLHTLKVRYHHDGSEVLQDDILLEVTDGTNSAEFVLHVEVFPVNDEPPVLKADLIPVMN
CSEGGEVVITSEYIFATDVDSDNLKLMFVIAREPQHGVVRRAGVTVDQFSQRDVISEAVT
YKHTGGEIGMMPCFDTITLVVSDGEAGPFVNGCCYNGPNPSVPLHASFPVYDLNITVYPV
DNQPPSIAIGAMFVVDEGCSTALTINHLSATDPDTAADDLEFVLVSPPQFGYLENILPSV
GFEKSNIGISIDSFQWEDMNAFHINYVQSRHLRIEPTADQFTVYVTDGKQHSLEIPFSII
INPTNDEAPDFVVQNITVCEGQMKELGSSIISAVDLDIPQDPLLFTITQKPRHGLLIYRG
FSKDFSENKQPANPHQKHVPVDSFSMELLKTGVRLTYMHDDSESLADDFIIQLSDGKHKI
RKTISVEVTPVNDEKPVLSKKAEIAMNMGETRIISSAILSAIDEDSPREKIYYVFERLPQ
NGQLQLKIGRDWVPLSPGMKCTQEEVDLNLLRYTHTGAMDSQNRDSFTFYLWDGDNRSPA
LDCQITIKDMEKGDIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLYVITSPPRYG
QVEYVHYPGVPITSFSQMDIAGQTVCYVHKSKVTVSSDRFRFIISNGLRTEHGVFEITLE
TVDRALPVVTRNKGLRLAQGSVGLLSPDLLQLTDPDTPAENLTFLLVQLPQHGQLYLWGT
GLLQHNFTQQDVDSRNVAYRHSGGDSQTDCFTFMATDRTNQGFVVNGRVWEEPVLFTIQV
DQLDKTAPRVTLLHSPSQVGLLKNGCYGIYITSRVLKASDPDTDNDQIIFKILQGPKHGH
LENTTTGEFIHEKFSQKDLNSKTILYIINPSLEVNSDTMEFQIMDPTGNSATPQILELKW
SHIEWSQTEYEVCENVGVLPLEITRRGYSMDSAFVGIKVNQVSAAVGKDFTMTPSKLIQF
DPGMSTKMWNIAITYDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSYS
SNQSKHSTWEKGIWRLLPPGSSSSTTSGSFHLERRPLPSSMQLAVTRGDILRGFDSTDLS
QRKLRTRGNGKTVRPLSVYRNGTDIIYNYHGIVSLKLEDDSFLTHKRKAKVSIISQPQKT
IKVAELPQEDKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLYQCNGISWKA
WSPQTKDMEDKSCPAGWHQHSGYCHILITEQKGTWNAAAQACREQYLGNLVTVFSRQHMR
WLWDIGGRKSFWIGLNDQVRAGHWEYSSLHACRSTRGSHGPSQRSKLGKSCVLVQRQGKW
QTKDCRRAKPHNYVCSRKL
Download sequence
Identical sequences ENSNLEP00000021381 ENSNLEP00000021381 XP_004087040.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]