SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021420 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021420
Domain Number 1 Region: 133-460
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.66e-54
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000024
Further Details:      
 
Domain Number 2 Region: 464-600
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.21e-19
Family Ricin B-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021420   Gene: ENSNLEG00000017643   Transcript: ENSNLET00000022508
Sequence length 607
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:25806355:26159655:-1 gene:ENSNLEG00000017643 transcript:ENSNLET00000022508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVYVRGQEPAPDKKLEEDKGDTL
KIIERLDHLENVIKQHIQEAPAKPEEAEAEPFTDSSLFAHWGQELSPEGRRVALKQFQYY
GYNAYLSDRLPLDRPLPDLRPSGCRNLSFPDSLPEVSIVFIFVNEALSVLLRSIHSAIER
TPPHLLKEIILVDDNSSNEELKEKLIEYVDKVNSQKPGFIKVVRHSKQEGLIRSRVSGWR
AATAPVVALFDAHVEFNVGWAEPVLTRIKENRKRIISPSFDNIKYDNFEIEEYPLAAQGF
DWELWCRYLNPPKAWWKLENSTAPIRSPALIGCFIVDRQYFQEIGLLDEGMEVYGGENVE
LGIRVWQCGGSVEVLPCSRIAHIERAHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVYMA
WNIPQEDSGIDIGDITARKALRKQLQCKTFRWYLVSVYPEMRMYSDIIAYGVLQNSLKTD
LCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRPRL
IECSYAKAKRMKLHWQFSQGGPIQNRKSKRCLELQENSDLQFGFQLVLQKCSGQHWSITN
VLRSLAS
Download sequence
Identical sequences G1S7D1
ENSNLEP00000021420 XP_012358374.1.23891 ENSNLEP00000021420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]