SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021443 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021443
Domain Number 1 Region: 1340-1651
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.21e-111
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000842
Further Details:      
 
Domain Number 2 Region: 1616-1904
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.33e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000931
Further Details:      
 
Domain Number 3 Region: 322-516
Classification Level Classification E-value
Superfamily Fibronectin type III 3.3e-45
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 4 Region: 514-711
Classification Level Classification E-value
Superfamily Fibronectin type III 2.24e-43
Family Fibronectin type III 0.0005
Further Details:      
 
Domain Number 5 Region: 823-1015
Classification Level Classification E-value
Superfamily Fibronectin type III 1.18e-36
Family Fibronectin type III 0.00071
Further Details:      
 
Domain Number 6 Region: 667-824
Classification Level Classification E-value
Superfamily Fibronectin type III 4.08e-30
Family Fibronectin type III 0.0008
Further Details:      
 
Domain Number 7 Region: 22-116
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-18
Family I set domains 0.0041
Further Details:      
 
Domain Number 8 Region: 126-217
Classification Level Classification E-value
Superfamily Immunoglobulin 2.07e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 9 Region: 234-328
Classification Level Classification E-value
Superfamily Immunoglobulin 2.79e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 10 Region: 1023-1145,1205-1251
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000389
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021443   Gene: ENSNLEG00000017664   Transcript: ENSNLET00000022531
Sequence length 1912
Comment pep:known_by_projection supercontig:Nleu1.0:GL397279.1:33406457:33843179:1 gene:ENSNLEG00000017664 transcript:ENSNLET00000022531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHVARLLLLLVTFFLRTDAETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKK
GKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLREDQ
IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRS
VHPGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRGFVPVRRVPPRFSI
PPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNVLELNDVRQSANY
TCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPEPVSYYIIQHKP
KNSEEPYKEIDGVATTRYSVAGLSPYSDYEFRVIAVNNIGRGPPSEPVLTQTSEQAPSSA
PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIG
NLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPR
SDTIANYELVYKDGEHGEEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEI
SARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAVDGEDDKPH
EILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSVLIRTNEDVPSGPPRKVEV
EAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEFDDT
TEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAVPGKPRLVINHTQMNTAL
IQWHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSEKEDHFTATDIHKGASYVFRLSARNK
VGFGEEMVKEISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGVITKYTLLYRD
INIPLLPMEQLIVPADTTMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVF
AKNFHVKAVMKTSVLLSWEIPENYNSAMPFKILYDDGKMVEEVDGRATQKLIVNLKPEKS
YSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNLDGMITVQLPEVPANENIKGY
YIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVLP
TEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPI
TDEEEGLIWVVGPVLAVVFIICIVIAILLYKRKRAESDSRKSSIPNSKEIPSHHPTDPVE
LRRLNFQTPGMASHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVN
KPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFW
RMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFAL
YKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRT
GCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEV
PARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMP
YESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIV
VMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTV
RQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIV
LERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFDHYAT
Download sequence
Identical sequences ENSNLEP00000021443 ENSNLEP00000021443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]