SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021515 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021515
Domain Number 1 Region: 1277-1419
Classification Level Classification E-value
Superfamily PH domain-like 3.42e-51
Family Phosphotyrosine-binding domain (PTB) 0.000000112
Further Details:      
 
Domain Number 2 Region: 309-436
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.9e-37
Family PLC-like (P variant) 0.0034
Further Details:      
 
Domain Number 3 Region: 1125-1273
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-24
Family SH2 domain 0.0014
Further Details:      
 
Domain Number 4 Region: 29-90
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000239
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021515
Domain Number - Region: 243-307
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.00185
Family Dual specificity phosphatase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021515   Gene: ENSNLEG00000017725   Transcript: ENSNLET00000022606
Sequence length 1421
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:59460010:59476030:-1 gene:ENSNLEG00000017725 transcript:ENSNLET00000022606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRGGVCVGRGDLLSSPQALGQLLRKESRPRRTMKPRKAEPHSFREKVFRKKPPVCAVCK
VTIDGTGVSCRVCKVATHRKCEAKVTSACQALPPAELRRNTAPVRRIEHLGSTKSLNHSK
QRSTLPRSFSLDPLMERRWDLDLTYVTERILAAAFPARPDEQRHRGHLRELAHVLQSKHR
DKYLSANERDVGSRWARLITDVTKRWGRGRGPGRGRDPELGLERSGESWNAGDLATLIPV
SVCQGNKGKLGVIVSAYMHYSKISAGADQALATLTMRKFCEDKVATELQPSQRRYISYFS
GLLSGSIRMNSSPLFLHYVLIPTLPAFEPGTGFQPFLKIYQSMQLVYTSGVYHIAGPGPQ
QLCISLEPALLLKGDVMVTCYHKGGQGTDRTLVFRVQFHTCTIHGPQLTFPKDQLDEAWT
DERFPFQASVEFVFSSSPEKIKGSTPRNDPSVSVNYNTTEPAVRWDSYENFNQHHEDSVD
GSLTHTRGPLDGSPYAQVQRPPRQNPPAPSPEPPPPPMLSVSSDSGHSSTLTTEPVAESP
GRPPPTAAERQELDRLLGGCGVAGGGRGAGRETAILDDEEQPPVGGGPHLGVYPGHRPGL
SRHCSCRQGYREPCGVPNGGYYRPEGTLERRRLAYGGYEGSPQGYTEASVEKRRLCRSLS
EGPYPYPPEMGKPATGDFGYRAPGYREVVILEDPGLPALYPCPACEEKLALPTAALYGLR
LEREAGEGWASEAGKSLLHPVRPGHPLPLLLPACGHHHAPIPDYSCLKPPKAGEEGHEGC
SYTMCPEGRYGHPGYPALVTYSYGGAVPSYCPAYGRVPHSCGSPGEGRGYPSPGAHSPRA
GSISPGSPPYPQSRKLSYEIPTEEGGDRYPLPGHSASAGPLASAESLEPVSWREGPSGHS
TLPRSPRDAPCSASSELSGPSMPLHTSSPVQCKESTRRQDTRSPTSAPTQRLSPGEALPP
VSQAGTGKAPELPSGSGPEPPAPSPVSPTFPPSSPSDWPQERSPVGHSDGASPRSPVPTT
LPGLRHTPWQGSRGPPDSPDGSPLTPVPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGL
TQPPLPEKRHLPGPGQQPGPWGPEQASSPARGISHHVTFAPLLSDNVPQPPEPPTQESQS
NVKFVQDTSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQ
PWKGDPVEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLRIPSK
DPLEETPEAPVPTNMSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPR
PTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKVFGF
VAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQRK
Download sequence
Identical sequences ENSNLEP00000021515 ENSNLEP00000021515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]