SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021518 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021518
Domain Number 1 Region: 69-266
Classification Level Classification E-value
Superfamily E set domains 1.96e-71
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000262
Further Details:      
 
Domain Number 2 Region: 2-84
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000267
Family Voltage-gated potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021518   Gene: ENSNLEG00000017728   Transcript: ENSNLET00000022609
Sequence length 303
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:32022240:32025631:-1 gene:ENSNLEG00000017728 transcript:ENSNLET00000022609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAIL
ILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFMLRVGDLRK
SMIISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLIIYHVIDANSPL
YDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYS
VDYSKFGNTIKVPTPLCTARQLDEDRSLLEALTLASARGPLRKRSVPMARAKPKFSISPD
SLS
Download sequence
Identical sequences XP_012358938.1.23891 ENSNLEP00000021518 ENSNLEP00000021518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]