SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021561 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021561
Domain Number 1 Region: 335-412
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 6.63e-21
Family Intermediate filament protein, coiled coil region 0.00059
Further Details:      
 
Domain Number 2 Region: 105-139
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000309
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021561
Domain Number - Region: 228-335
Classification Level Classification E-value
Superfamily Prefoldin 0.000126
Family Prefoldin 0.011
Further Details:      
 
Domain Number - Region: 143-213
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000523
Family Intermediate filament protein, coiled coil region 0.0075
Further Details:      
 
Domain Number - Region: 7-101,422-486
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0235
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021561   Gene: ENSNLEG00000017757   Transcript: ENSNLET00000022652
Sequence length 486
Comment pep:novel supercontig:Nleu1.0:GL397261.1:60199934:60207217:-1 gene:ENSNLEG00000017757 transcript:ENSNLET00000022652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCGSYCGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCG
RSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAF
IDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFEGYIETLRREAECVEADSGRLASEL
NHVQEVLEGYKKKYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLR
QLYEEEIRVLQSHISDTSVVVKLDNSRDLNMDCIVAEIKAQYDDIVTRSRAEAESWYRSK
CEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQQGEAA
LSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEG
VGSVNVCVSSSRGGVVCGDLCASTTAPVVSTRVSSVPSNSNVVVGTTNACAPSIGVGVCG
GSCKKC
Download sequence
Identical sequences G1S7S2
ENSNLEP00000021561 ENSNLEP00000021561 XP_003252153.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]