SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021602 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021602
Domain Number 1 Region: 799-988
Classification Level Classification E-value
Superfamily Fibronectin type III 1e-41
Family Fibronectin type III 0.00037
Further Details:      
 
Domain Number 2 Region: 1212-1305
Classification Level Classification E-value
Superfamily Immunoglobulin 1.13e-22
Family I set domains 0.0069
Further Details:      
 
Domain Number 3 Region: 614-705
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-21
Family I set domains 0.0087
Further Details:      
 
Domain Number 4 Region: 1079-1182
Classification Level Classification E-value
Superfamily Fibronectin type III 7.62e-20
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 5 Region: 683-789
Classification Level Classification E-value
Superfamily Fibronectin type III 1.19e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 6 Region: 1011-1100
Classification Level Classification E-value
Superfamily Immunoglobulin 9.31e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 7 Region: 410-508
Classification Level Classification E-value
Superfamily Immunoglobulin 1.93e-16
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 325-413
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000471
Family I set domains 0.013
Further Details:      
 
Domain Number 9 Region: 235-328
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000314
Family I set domains 0.035
Further Details:      
 
Domain Number 10 Region: 517-603
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000328
Family I set domains 0.018
Further Details:      
 
Domain Number 11 Region: 100-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000043
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021602   Gene: ENSNLEG00000017788   Transcript: ENSNLET00000022694
Sequence length 1325
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:33289378:33312640:-1 gene:ENSNLEG00000017788 transcript:ENSNLET00000022694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTIHSQQMLQEHVSMEFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNI
PEGDSVPEFVEKPQPVTAPEGVLLLVAPWVPXXXXXXXXXKRESGIPIKSPAKILDSIIK
EHVLKLEPLTLDDSDNYKCIASNDHADAIYTVSLQVTEGQEKMDFKKMLKKRAPPAPKKK
QKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPLE
DKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNVN
MNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVWK
FNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDTGEFSAEAGNLAQKAQLTIDRIPIKF
VSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQ
LSDGGEYTVVATQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEK
VEGVWLKDGKEITDLPGVQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGAESEASVFIADP
PTIDPSVLEALAAHPITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGED
QALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMK
WKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNS
EGVSDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERR
KKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKDPVK
PPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRAEDTKEWSKCTKIPISGTCYT
VGGLTERQKYFFRIRAVNEAGVGEPVELDEGVRAMPPPAAPKFDLSARLKSHMVVRAGTA
LCIHAAFSGSPPPDVIWQKDGVPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEF
GEAHYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYVIMKRDASTAT
WYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLDSKDTWLINKDQIQDLSAKL
KPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANSKFWY
NSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTVYDKDDKSIVASITESLQKK
SKHLM
Download sequence
Identical sequences ENSNLEP00000021602 ENSNLEP00000021602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]