SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021656 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021656
Domain Number 1 Region: 256-335
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.57e-19
Family Chaperone J-domain 0.0008
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021656
Domain Number - Region: 102-159
Classification Level Classification E-value
Superfamily Subtilisin-like 0.0205
Family Subtilases 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021656   Gene: ENSNLEG00000017829   Transcript: ENSNLET00000022748
Sequence length 341
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:63183833:63188640:-1 gene:ENSNLEG00000017829 transcript:ENSNLET00000022748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWDFWKLPSFVAQAN
RAQGRRQSPRGVTPPLSPIRFAAQVIVGIYFGLVALISLSSTVSFYIVALPLAVGLGVLL
VAAVGNQTSDFKNTLGAAFLTSPIFYGRPIAILPISVAASITAQKHRRYKALVTSEPLSV
RLYRLGLAYLAFTGPLAYSALCNTAATLSYVAETFGSFLNWFSFFPLLGRLMEFVLLLPY
RIWRLLMGETGFNSSYFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYREL
VKVWHPDHNLDQTEEAQRHFLEIQAAYKVLSQPRRPRRSRR
Download sequence
Identical sequences G1S817
ENSNLEP00000021656 ENSNLEP00000021656 XP_003252233.1.23891 XP_003252234.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]