SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021717 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021717
Domain Number 1 Region: 899-990
Classification Level Classification E-value
Superfamily Doublecortin (DC) 9.94e-20
Family Doublecortin (DC) 0.0088
Further Details:      
 
Domain Number 2 Region: 121-185
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.00000000000458
Family Doublecortin (DC) 0.012
Further Details:      
 
Domain Number 3 Region: 646-708
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.00000000379
Family Doublecortin (DC) 0.0056
Further Details:      
 
Domain Number 4 Region: 365-422
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000492
Family Ricin B-like 0.026
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021717
Domain Number - Region: 2-68
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.0144
Family Doublecortin (DC) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021717   Gene: ENSNLEG00000017872   Transcript: ENSNLET00000022810
Sequence length 1024
Comment pep:novel supercontig:Nleu1.0:GL397264.1:45381503:45481748:-1 gene:ENSNLEG00000017872 transcript:ENSNLET00000022810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKPICKTTEPYAPVRLRVLRNGDKNKHRSITILGPDISPGQKTQAFPGLVLEGRGLWEW
EISVQCLTRLKTSVSKVVKVITMTPSLLVEGAEELGDKLDFDNLGERARLHQKTPRKNSF
RCTEVLNFPSAARRLYSEKGKEIFALKDLQKDELVYVSCGEHWIHPDLSIAQQKKQIFLR
NLESDIAKIAKIQIFSSTHKIEVLVTEPPHPCLASTFGKLPKKILSNSWVLAAPPRNQIP
VHVAGYTSDWSSKEVQSDIVSGNKLAVHKPVAIFGEEKQVTGPEEKQMQEDALTMENASS
EILDSHARAHLRLKACHTVFRYAWQETSHDFDEDDSLPKKMEKELFENVEPQKEHSCSPK
HSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVLVEKKSDGSHQHWIHQE
DSRTFCTFVILGAPHVKPRKREAVSRREMVILVDPLLETSESREKRTFHLVSNPDLVLAV
SMIKTRNEVCGCPVIVQKYKPYNNGAANHKWHYMKNKALVAFHSTALDKEITSANCAGVC
TSSVIKEENIDQPGYCSLSPDGKRKAMLCLACGQSMRTEKGLKQLLPGVPFLCISGTKTQ
KPFLQGPFKVISVAEAEKTLSYYQAHLLSLQMKTCTQAASHSTMAATHQKAVKIIAYKNW
DGYCNGKIVARTFPILLTECTEQPGLARAASKVYTKDGTPIFTLRDLVLWALDESLLQRD
SEKQKQDAAPVGKEQIIVESMEENPRMKVKNGLFAKPVTSDSLDGIDKSLLILILRNPIA
IWVSCGEPFLPPNALQKAEKLEKQNWKKDRILADLDIMRHKIRQLKGRRVAACQPATMVP
TKSPVQPVVVEGGWTEQTQEEIKLMELRRHTEAHLSEIQEMESKINFPIATKCIAVKPSN
LYKQPNTKRVWIYLNGGRPEDDTYAWGKTISELLQDCSSRLKMTHPARALYTPDAAPIQS
WDDIERDMVICVSMGHGFKTPKELKQLMEIRANYARIRRQQGPQATDIVVSPSMKLLSLV
HLHH
Download sequence
Identical sequences ENSNLEP00000021717 ENSNLEP00000021717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]