SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021719 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021719
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Doublecortin (DC) 5.62e-18
Family Doublecortin (DC) 0.0092
Further Details:      
 
Domain Number 2 Region: 487-549
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.00000000196
Family Doublecortin (DC) 0.0056
Further Details:      
 
Domain Number 3 Region: 242-346
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000437
Family Ricin B-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021719   Gene: ENSNLEG00000017872   Transcript: ENSNLET00000022812
Sequence length 644
Comment pep:novel supercontig:Nleu1.0:GL397264.1:45448391:45481748:-1 gene:ENSNLEG00000017872 transcript:ENSNLET00000022812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKPICKTTEPYAPVRLRVLRNGDKNKHRSITILGPDISPGQKTQCTEVLNFPSAARRLY
SEKGKEIFALKDLQKDELVYVSCGEHWIHPDLSIAQQKKQIFLRNLESDIAKIAKIQIFS
STHKIEALVLEVQSDIVSGNKLAVHKPVAIFGEEKQVTGPEEKQMQEDALTMENASSEIL
DSHARAHLRLKACHTVFRYAWQETSHDFDEDDSLPKKMEKELFENVEPQKEHSCSPKHSK
LHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVLVEKKSDGSHQHWIHQEDSR
TFHLVSNPDLVLAVSMIKTRNEVCGCPVIVQKYKPYNNGAANHKWHYMKNKALVAFHSTA
LDKEITSANCAGVCTSSVIKEENIDQPGYCSLSPDGKRKAMLCLACGQSMRTEKGLKQLL
PGVPFLCISGTKTQKPFLQGPFKVISVAEIDLSCDKAEKTLSYYQAHLLSLQMKTCTQAA
SHSTMAATHQKAVKIIAYKNWDGYCNGKIVARTFPILLTECTEQPGLARAASKVYTKDGT
PIFTLRDLVLWALDESLLQRDSEKQKQDAAPVGKEQIIVEKNPRMKVKNGLFAKPVTSDS
LDGIDKSLLILILRNPIAIWVSCGEPFLPPNESRKIRETELAKK
Download sequence
Identical sequences ENSNLEP00000021719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]