SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021720 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021720
Domain Number 1 Region: 284-384
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000103
Family Ricin B-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021720   Gene: ENSNLEG00000017875   Transcript: ENSNLET00000022813
Sequence length 499
Comment pep:novel supercontig:Nleu1.0:GL397264.1:45503255:45685499:-1 gene:ENSNLEG00000017875 transcript:ENSNLET00000022813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNLVMNEQKEKITEKVILSMTAKEHHKEQEEVSRLIDELQTAIKSNRGHLCKLGPQLQAE
QEQFSSYVYQHIKSLPANTLVPGGLQLKVFENGKNTGEISVGISKKDLESDSPIQTDYMM
ERLLLKIHQRLQGSSINPPGLNFSSMRLFDENGQEIKNPLSLKSEQKIWVSYGRAYRSPL
NLALGLTFDRVSAFARGVIMVAYKTFLDPNAVLLPGYGNWEVCEGFPINFNCTSQQIPDQ
FEKVDLENHFLKNKVDPNIVLHASVSIGKWSFSGSEASSRSQIAPSILWPVASVWLITKT
GMILSRAITQGCLAIGHPIRVKAAEGTSLEGYKLILQKRHSGDESQKWVFATDGCIYSKA
YPQFVLTYLEELNAQVDVTQTEYHIHHGAWTTAHQEHGRNLAEEVLQESASNPGLKQLPE
PSDTHLMPEGSLEETGQLTVALVRKLEEKHPKASAQRWAIKHEGTSKPGQWKHSRVENPL
NKLTYMWPVLPSGQLNEVV
Download sequence
Identical sequences ENSNLEP00000021720 ENSNLEP00000021720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]