SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021723 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021723
Domain Number 1 Region: 20-141
Classification Level Classification E-value
Superfamily Lysozyme-like 7.19e-46
Family C-type lysozyme 0.000000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021723   Gene: ENSNLEG00000017877   Transcript: ENSNLET00000022816
Sequence length 142
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:63894517:63896905:1 gene:ENSNLEG00000017877 transcript:ENSNLET00000022816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFFVPLFLVGILFPAIPAKQFTKCELSQLLKDIDGYGGIALPELICTIFHTSGYDTQAI
VENSESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGI
DYWLAHKALCTEKLEQWLCEKL
Download sequence
Identical sequences G1S884
ENSNLEP00000021723 XP_003252260.1.23891 ENSNLEP00000021723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]