SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021734 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021734
Domain Number 1 Region: 392-805
Classification Level Classification E-value
Superfamily Phosphofructokinase 4.19e-110
Family Phosphofructokinase 0.00000763
Further Details:      
 
Domain Number 2 Region: 68-390
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.44e-105
Family Phosphofructokinase 0.000000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021734   Gene: ENSNLEG00000017887   Transcript: ENSNLET00000022830
Sequence length 832
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:64226750:64254427:-1 gene:ENSNLEG00000017887 transcript:ENSNLET00000022830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVEVGKALLLPPPSLPPPGSSPCSSSTPPPFPKDNLQESSGGGELRLKEWIMTHEEHHA
AKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEA
TWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTF
RSEWSDLLIDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEI
VDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLS
ETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAF
DRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMDEKKFD
EALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLI
QGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISANITKF
NIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSVGADTALNT
ICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQAN
VEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSP
TPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANSPDSGCVLGMRKRALVFQPVTELKD
QTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEAAV
Download sequence
Identical sequences ENSNLEP00000021734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]